Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●QUARK ●LOMETS ●COACH ●COFACTOR ●MetaGO ●MUSTER ●CEthreader ●SEGMER ●FG-MD ●ModRefiner ●REMO ●DEMO ●SPRING ●COTH ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●GPCR-I-TASSER ●MAGELLAN ●BindProf ●BindProfX ●SSIPe ●ResQ ●IonCom ●STRUM ●DAMpred

●TM-score ●TM-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13

[Back to server]

DEMO-EM Results for job DOEM646818666

[Click on DOEM646818666_results.tar.bz2 to download the tarball file including all results listed on this page]


  Input Sequence and Domain Definition

>example (780 residues)
MEVEKYDLTLDFDIQKRTFNGTETITADAGDIVLDAVGLQINWMKVNGRDTAFTYDGQTVRAPGDSQPQKIEISFAGKVSDSLSGIYYAGRENGMITTHF
EATDARRMFPCVDHPAYKAVFAITVVIDKDYDAISNMPPKRIEVSERKVVEFQDTPRMSTYLLYVGIGKFRYEYEKYRDIDLILASLKDIRSKYPLDMAR
KSVEFYENYFGIPYALPKMHLISVPEFGAGAMENWGAITFREIYMDIAENSAVTVKRNSANVIAHEIAHQWFGDLVTMKWWNDLWLNESFATFMSYKTMD
TLFPEWSFWGDFFVSRTSGALRSDSLKNTHPIEVDVRDPDEISQIFDEISYGKGASILRMIEDYAGYEEFRKGISKYLNDHKFGNAEGSDLWTAIEDVSG
KPVKRVMEYWIKNPGYPVIKLKRNGRKITMYQTRFLLNGEEEGRWPVPVNIKKKDGVERILLEDEASIEADGLIKINADSAGFYRVLYDDATFSDVMGHY
RDLSPLDRIGLVDDLFAFLLSGHIDPETYRQRIRNFFDDEDHNVITAIVGQMEYLRMLTHAFDDDARAFCRSRMQFLTGKQDENLKIALGRVSRLYVMVD
ESYAEEMSKLFKDFDSAEPEMRSSIATAYALVTGDLKGLLEKFRSVDRDEDRVRIISAFGKLKSNTDLSTVYGMVEKTEIKKQDMISFFSSALETLPGRE
FIFANLDRIIRLVIRYFTGNRTASRTVEMMIPVIGLDHPDAEDIVRNIGSKNISMGLAKGIEMLAVNRKLVERIRQTAVK
|                  |                   |                   |                   |                   |
0                 20                  40                  60                  80                 100
  • D1:1-169
  • D2:170-414
  • D3:415-488
  • D4:489-780
(Different color means different domains. 4 domains in total)

  Individual Domain Structures

(By dragging your mouse on the images, you can rotate and zoom the structure)
Structure of domain 1 (download dom1.pdb)
Structure of domain 2 (download dom2.pdb)
Structure of domain 3 (download dom3.pdb)
Structure of domain 4 (download dom4.pdb) 		                    

  Final Full-length Structures

Top 5 models constructed by DEMO-EM

Click
to view		 CC-score FSC-score Estimated
TM-score		 PDB file
Model 1 0.98 0.72 0.99 Download
Model 2 0.97 0.71 0.98 Download
Model 3 0.96 0.70 0.97 Download
Model 4 0.96 0.70 0.97 Download
Model 5 0.94 0.69 0.95 Download
 
(a) The top 5 full-length models are selected based on energy from all models generated in the simulation.
(b) CC-score is the correlation coefficient score between experimental density and that probed from the model.
(c) FSC-score is the Fourier shell correlation score between experimental density and that probed from the model.
(d) TM-score is estimated based on CC-score and FSC-score following the correlation observed between them.

   Residue's CC-score of Final Models

(By clicking the legend name at the top of the figure, you can hide the corresonding line)
(By moving your mouse on the figure, you can see the CC-score of each residue)

           


[Back to server]

Reference:
  • Xiaogen Zhou, Yang Li, Chengxin Zhang, Wei Zheng, Guijun Zhang, Yang Zhang. Progressive assembly of multi-domain protein structures from cryo-EM density maps. Nature Computational Science, 2: 265-275 (2022).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218