MetaGO result for job id PF16316

User Input

>PF16316 (188 residues)
DFFELLVKAVFNFLVIGYIVRYLYYPATKNKDYLFTYLLISVTVFCLCFLLENVKLELGF
ALGLFAIFGIIRYRTDPIPIKEMTYLFIVIGVSVINALANKKISHAELLFTNLLVVAVTY
GLEKIWLLKHESRKTITYEKIELITPDKHDELVADLKERTGLNVTRVEIRKIDFLRDTAQ
LRVFYFEE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5a63C	0.56	4.46	0.060	0.803	Download
2	4av3A	0.51	5.11	0.027	0.867	Download
3	3ov2A	0.51	4.64	0.057	0.787	Download
4	3wd8A	0.51	4.76	0.070	0.798	Download
5	3tsyA2	0.51	4.90	0.069	0.803	Download
6	2p0uA	0.51	4.73	0.064	0.787	Download
7	5wx3A	0.51	4.77	0.082	0.793	Download
8	2hs3A	0.51	4.97	0.075	0.808	Download
9	5ucoA	0.51	4.88	0.070	0.798	Download
10	3e1hA	0.51	4.87	0.056	0.814	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016746	0.02	transferase activity, transferring acyl groups

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0048013	0.01	ephrin receptor signaling pathway
GO:0043085	0.01	positive regulation of catalytic activity
GO:0043065	0.01	positive regulation of apoptotic process
GO:0042987	0.01	amyloid precursor protein catabolic process
GO:0035725	0.01	sodium ion transmembrane transport
GO:0031293	0.01	membrane protein intracellular domain proteolysis
GO:0016485	0.01	protein processing
GO:0015992	0.01	proton transport
GO:0009813	0.01	flavonoid biosynthetic process
GO:0009698	0.01	phenylpropanoid metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0032580	0.01	Golgi cisterna membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]