MetaGO result for job id PF16375

User Input

>UniRef100_R6J6H4/54-137 (84 residues)
GTEYLDGLYADDSRGGHIAHGKQIPLQEVPMLIGNPDSICKSLQKEQNSRITFSYNGEVY
PAQGKALKLVPFFRLHNSRYAVYF

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3qi7A	0.48	4.11	0.052	0.845	Download
2	1im0A	0.47	3.83	0.068	0.809	Download
3	2xrnA	0.47	4.21	0.105	0.893	Download
4	5fq6B	0.47	3.68	0.106	0.786	Download
5	4yu5A	0.47	4.03	0.068	0.833	Download
6	1tf1A	0.46	3.77	0.075	0.833	Download
7	2g7uA	0.46	4.25	0.063	0.917	Download
8	1ysqA	0.46	4.39	0.092	0.881	Download
9	3mq0A	0.45	4.00	0.066	0.869	Download
10	2o9aA	0.45	4.24	0.105	0.881	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004553	0.69	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003676	0.03	nucleic acid binding
GO:0046556	0.02	alpha-L-arabinofuranosidase activity
GO:0004558	0.02	alpha-1,4-glucosidase activity
GO:0001071	0.02	nucleic acid binding transcription factor activity
GO:0047513	0.01	1,2-alpha-L-fucosidase activity
GO:0046558	0.01	arabinan endo-1,5-alpha-L-arabinosidase activity
GO:0033914	0.01	xylan 1,3-beta-xylosidase activity
GO:0030247	0.01	polysaccharide binding
GO:0015925	0.01	galactosidase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.78	metabolic process
GO:0071704	0.75	organic substance metabolic process
GO:0044238	0.66	primary metabolic process
GO:0005975	0.57	carbohydrate metabolic process
GO:0009987	0.19	cellular process
GO:0044237	0.17	cellular metabolic process
GO:0043170	0.15	macromolecule metabolic process
GO:0009056	0.10	catabolic process
GO:0005976	0.10	polysaccharide metabolic process
GO:1901575	0.09	organic substance catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.20	cell part
GO:0005576	0.20	extracellular region
GO:0016020	0.09	membrane
GO:0044444	0.07	cytoplasmic part
GO:0005886	0.07	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]