MetaGO result for job id PF14550

User Input

>UniRef100_A0A1B7KP74/1-393 (393 residues)
MPRELVNAHITHVSYVDKGANKKQFFLTKSEEKSTFQKEVRVFVNKEEEEQKLVYGVVYE
PDVVDAHGDFMTAEEIEKAAHVFMKDYRNIDKQHDFNAGVGEVVESYIAPTDFKIGDEEI
KKGSWVLVTKASDEIWEQIKKGEITGYSMAGTAEVIEKQEEKPVTKSNEDDEVKGFFNLL
KNFFTGEKIQKGAVRDKYEQGKKARNFWAAMDSFETTIRSYNWQMDKYVFEEDETKIREA
IQDFVDIMNEILLADNVLKAIGKPPEDIQKAGRKISAANMQKIKDAHAALADLIALEEEE
EEVKKEDIEKLLDEKLSPIVKRLDEIEKGDSANPSGEGGGEEDITRQFSEILDAKLAPIN
ERLEAVEKARSVSKQVDSEPLNQQTNQVAKSYM

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2vdcA	0.40	6.48	0.028	0.639	Download
2	3ig5A	0.39	6.90	0.046	0.656	Download
3	3fvyA	0.39	6.94	0.030	0.649	Download
4	1llwA	0.39	6.42	0.068	0.603	Download
5	5dotA	0.39	7.47	0.042	0.687	Download
6	4o5pA	0.38	6.92	0.035	0.649	Download
7	1kbiA	0.33	7.13	0.036	0.555	Download
8	1v59A	0.32	7.01	0.056	0.550	Download
9	3cskA1	0.30	7.44	0.031	0.532	Download
10	4jzaA	0.29	7.06	0.024	0.499	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0043169	0.02	cation binding
GO:0008094	0.01	DNA-dependent ATPase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.10	single-organism process
GO:0009987	0.03	cellular process
GO:0050794	0.02	regulation of cellular process
GO:0044767	0.02	single-organism developmental process
GO:0044763	0.02	single-organism cellular process
GO:0044710	0.02	single-organism metabolic process
GO:1902685	0.01	positive regulation of receptor localization to synapse
GO:1900101	0.01	regulation of endoplasmic reticulum unfolded protein response
GO:0098792	0.01	xenophagy
GO:0098779	0.01	mitophagy in response to mitochondrial depolarization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005875	0.01	microtubule associated complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]