MetaGO result for job id PF14401

User Input

>UniRef100_C0N2Z0/1-489 (489 residues)
MTKHLIVVENIQDWSPYFPSEQVIGVDDYLQSPSQRSDSRAQILNLCRSLEYLSRGYYCS
MVAEARGHRVLPGLRTINDLSRKSLYAYDLSDMSSQLDKQLASTEQSASFILTISFGQTP
IASLQKLARQIFEHFPCPILEVEFSFKGHWIISQIKAGAINKLTEQEQDFFAEALDSFSH
RLWRKPSKRRQFRYDMAILHNPKEAMPPSNMAALKKFISSGRRIGIDVELITPREYIRLA
EYDALFIRETTATHNHTYKFARRAESEGLVVIDDPTSIIRCTNKIFLKELLAAHDLPMPE
SHLLYRNDQAGLDNLCETATFPLVMKIPDGAFSIGVIKVKNAEELRQQAAVFFQQSAIIL
LQEFMYTDYDWRIGVFNNKAIYACQYFMSKGHWQIYNHNSKKGTDSGKSSAIPVSEVPEK
VIRIATKAAKLIGDGLYGIDIKQSGNRIVIIEINDNPSIDSGVEDEYLGMALYDDIMREF
LRRLEEKKS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1bxrA	0.43	6.16	0.090	0.622	Download
2	3vthA	0.41	7.59	0.048	0.685	Download
3	5dotA	0.41	6.33	0.051	0.601	Download
4	4g9iA	0.40	7.62	0.046	0.681	Download
5	3ln6A	0.40	7.00	0.070	0.632	Download
6	3tspA	0.40	7.65	0.058	0.677	Download
7	4m5dA	0.40	7.77	0.046	0.687	Download
8	2qb5A	0.38	5.34	0.077	0.513	Download
9	3i12A	0.36	5.62	0.176	0.503	Download
10	1kjiA	0.36	5.52	0.116	0.499	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016874	0.19	ligase activity
GO:0016879	0.14	ligase activity, forming carbon-nitrogen bonds
GO:0035639	0.06	purine ribonucleoside triphosphate binding
GO:0032559	0.06	adenyl ribonucleotide binding
GO:0032550	0.06	purine ribonucleoside binding
GO:0016881	0.06	acid-amino acid ligase activity
GO:0004639	0.05	phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
GO:0004638	0.05	phosphoribosylaminoimidazole carboxylase activity
GO:0043169	0.04	cation binding
GO:0016885	0.01	ligase activity, forming carbon-carbon bonds

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044281	0.14	small molecule metabolic process
GO:1901576	0.13	organic substance biosynthetic process
GO:0044763	0.13	single-organism cellular process
GO:0044711	0.13	single-organism biosynthetic process
GO:0044237	0.13	cellular metabolic process
GO:1901566	0.12	organonitrogen compound biosynthetic process
GO:0044249	0.12	cellular biosynthetic process
GO:0044238	0.12	primary metabolic process
GO:0044271	0.11	cellular nitrogen compound biosynthetic process
GO:1901362	0.08	organic cyclic compound biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0031966	0.01	mitochondrial membrane
GO:0005829	0.01	cytosol
GO:0005739	0.01	mitochondrion
GO:0005737	0.01	cytoplasm

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]