MetaGO result for job id PF14105

User Input

>k87_1036169_1_1/1-85 (85 residues)
SPIGALTTPFEAIPMTTAQRTYRGIPYDPAQHERLSPASVDHTYRGQHYDAPLCHAAAAE
TTVELHYRGSVYQHRREQARKPVNS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1dxxA2	0.49	3.42	0.069	0.753	Download
2	1rt8A3	0.48	3.61	0.026	0.788	Download
3	1wylA	0.48	3.51	0.066	0.788	Download
4	3ogzA	0.48	4.15	0.133	0.859	Download
5	1wypA	0.48	3.99	0.091	0.800	Download
6	1hxgA	0.47	4.10	0.075	0.859	Download
7	2d87A	0.47	3.54	0.053	0.753	Download
8	2cwnA	0.47	4.30	0.025	0.812	Download
9	3zgwA	0.47	4.44	0.073	0.918	Download
10	4iu2B	0.47	3.68	0.042	0.800	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0050660	0.03	flavin adenine dinucleotide binding
GO:0046914	0.03	transition metal ion binding
GO:0016705	0.03	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0008092	0.03	cytoskeletal protein binding
GO:0004497	0.03	monooxygenase activity
GO:0019904	0.02	protein domain specific binding
GO:0017016	0.02	Ras GTPase binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0055114	0.03	oxidation-reduction process
GO:0051261	0.03	protein depolymerization
GO:0008154	0.03	actin polymerization or depolymerization
GO:0006790	0.03	sulfur compound metabolic process
GO:2000117	0.02	negative regulation of cysteine-type endopeptidase activity
GO:0043281	0.02	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043069	0.02	negative regulation of programmed cell death
GO:0042326	0.02	negative regulation of phosphorylation
GO:0031400	0.02	negative regulation of protein modification process
GO:0001932	0.02	regulation of protein phosphorylation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005856	0.03	cytoskeleton
GO:0098858	0.01	actin-based cell projection
GO:0098590	0.01	plasma membrane region
GO:0097458	0.01	neuron part
GO:0070938	0.01	contractile ring
GO:0070062	0.01	extracellular exosome
GO:0044463	0.01	cell projection part
GO:0044449	0.01	contractile fiber part
GO:0044430	0.01	cytoskeletal part
GO:0042383	0.01	sarcolemma

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]