MetaGO result for job id PF13651

User Input

>UniRef100_A0A1C6E3L0/1-466 (466 residues)
MAKNSGLSKAKNAKKDEFYTSYEVIQAEINHYEDKFKNKTVLCNCDDPFESNFCKFFLRN
FNYLKLKRLICTSYSTSPIVGQQLTLVGWNEEPIKRGNGYVMDISEVPMANGRGVSDSDI
DSLLKSKNSGVKKLKGDGDFRSDECIEYMKQADVVITNPPFSLFREYVAQLIEYEKNFLI
IGNVNAITYKEIFPLIKDNKMWLGASIHSGDRKFYVPDDYPLKASGCGEDENGRKFIRVK
GVRWFTNLDYTKRHEELVLYKKYYGNEEEYPKYDNYDAINVDKTADIPCDYFEYMAVPIT
YTDKYNPDQFEIINANDIRTNPDTPIKAHGLIKDKDAVITTQIYTKNAEKDLTQTAKTGT
ILTDRQTDRQTDRQTDRQTDRQTDRQTDRQTDELHMQELSSGERCNGVMGVPITFLDKYN
PDQFEIIGLAAGNIRGLAGITSRTGKDGPYIGGKLRYGRIFVKKKM

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2uvcG	0.44	7.32	0.052	0.723	Download
2	3hmjG	0.44	6.98	0.031	0.695	Download
3	2pffB	0.43	7.31	0.057	0.706	Download
4	5mqmA	0.40	7.06	0.043	0.659	Download
5	5gsmA	0.40	7.42	0.037	0.672	Download
6	5gslA	0.39	7.31	0.032	0.646	Download
7	4uzsA	0.39	7.42	0.039	0.650	Download
8	4p8qA	0.39	7.21	0.035	0.633	Download
9	5xb7A	0.39	7.33	0.029	0.639	Download
10	3ttsA	0.39	7.41	0.048	0.637	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016757	0.04	transferase activity, transferring glycosyl groups
GO:0004016	0.03	adenylate cyclase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044711	0.16	single-organism biosynthetic process
GO:1901576	0.15	organic substance biosynthetic process
GO:0044238	0.12	primary metabolic process
GO:0044723	0.04	single-organism carbohydrate metabolic process
GO:1901362	0.03	organic cyclic compound biosynthetic process
GO:0018130	0.03	heterocycle biosynthetic process
GO:0006796	0.03	phosphate-containing compound metabolic process
GO:0000271	0.03	polysaccharide biosynthetic process
GO:0019933	0.02	cAMP-mediated signaling
GO:0007193	0.02	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005886	0.02	plasma membrane
GO:0044445	0.01	cytosolic part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]