MetaGO result for job id PF13625

User Input

>UniRef100_F8E2H8/5-131 (127 residues)
NGPLIVQSDKTVLLEIDHEQAQEARTALAPFAELERAPEHVHTYRITPLALWNARAAGHD
AEQVMDVLENYSRFPVPQPLLIDIADTMDRYGRLKLIKHPAHGLVLETTDRAVLTEIRRH
KKIKPML

Download query sequence and structure

Proteins with similar structure

Spin On/Off

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6qp6A2	0.45	4.69	0.092	0.811	Download
2	3s8vA	0.44	4.90	0.041	0.803	Download
3	5oybA	0.44	4.68	0.119	0.787	Download
4	1n7dA4	0.44	4.90	0.026	0.803	Download
5	3s94A	0.43	4.81	0.017	0.787	Download
6	5b4xB	0.43	5.00	0.017	0.819	Download
7	5wvqA	0.43	4.90	0.020	0.787	Download
8	3fawA4	0.43	4.72	0.040	0.779	Download
9	4j7rA	0.43	4.84	0.030	0.787	Download
10	6a3fA	0.43	5.07	0.026	0.795	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.99	catalytic activity
GO:0016772	0.72	transferase activity, transferring phosphorus-containing groups
GO:0016787	0.41	hydrolase activity
GO:0016462	0.22	pyrophosphatase activity
GO:0008353	0.17	RNA polymerase II carboxy-terminal domain kinase activity
GO:1901363	0.16	heterocyclic compound binding
GO:0097159	0.15	organic cyclic compound binding
GO:0017111	0.13	nucleoside-triphosphatase activity
GO:0003676	0.09	nucleic acid binding
GO:0003677	0.08	DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.96	metabolic process
GO:0009987	0.95	cellular process
GO:0071704	0.94	organic substance metabolic process
GO:0044237	0.94	cellular metabolic process
GO:0006807	0.91	nitrogen compound metabolic process
GO:0044238	0.89	primary metabolic process
GO:0034641	0.87	cellular nitrogen compound metabolic process
GO:1901360	0.85	organic cyclic compound metabolic process
GO:0046483	0.85	heterocycle metabolic process
GO:0006725	0.83	cellular aromatic compound metabolic process
GO:0043170	0.82	macromolecule metabolic process
GO:0006139	0.81	nucleobase-containing compound metabolic process
GO:0044260	0.80	cellular macromolecule metabolic process
GO:0090304	0.75	nucleic acid metabolic process
GO:0050896	0.51	response to stimulus
GO:0006259	0.43	DNA metabolic process
GO:0065007	0.41	biological regulation
GO:0050789	0.40	regulation of biological process
GO:0050794	0.35	regulation of cellular process
GO:0006950	0.33	response to stress
GO:0044699	0.32	single-organism process
GO:0051716	0.29	cellular response to stimulus
GO:0033554	0.27	cellular response to stress
GO:0006974	0.26	cellular response to DNA damage stimulus
GO:1901576	0.21	organic substance biosynthetic process
GO:0006281	0.21	DNA repair
GO:0044249	0.20	cellular biosynthetic process
GO:0009059	0.12	macromolecule biosynthetic process
GO:0060255	0.11	regulation of macromolecule metabolic process
GO:0051252	0.10	regulation of RNA metabolic process
GO:0051179	0.10	localization
GO:0034645	0.10	cellular macromolecule biosynthetic process
GO:0010468	0.10	regulation of gene expression
GO:2001141	0.09	regulation of RNA biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044424	0.87	intracellular part
GO:0044444	0.35	cytoplasmic part
GO:0005829	0.28	cytosol
GO:0005886	0.17	plasma membrane
GO:0061695	0.14	transferase complex, transferring phosphorus-containing groups
GO:0005618	0.07	cell wall
GO:0005576	0.07	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]