MetaGO result for job id PF13600

User Input

>UniRef100_N1RHG6/13-262 (250 residues)
VSHKVEYKIRDLGTRSVTLFPTQAQVKREIKNVPLKPGVNEISIVGLSPTIDKNSVTVEG
SGAATITGISVEFLPNRELFDEVYPDSDDNDDSDSDDEEEGEGEPPEVPQHGELLETKMK
LIELKDEQQRAREIIGNADERIKVLDIYSKSLDKREGVNISEMLDTYKQEHQKAFEERLV
GVQRERELTEAINKVTKEQMRLNKLGNKFQKKEAKNKARIQKAVQKKQEQRQKRQEEKRK
EKERIRNERS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3rkoL	0.47	5.97	0.032	0.796	Download
2	6nbqF	0.46	6.03	0.041	0.784	Download
3	4he8N	0.46	5.95	0.030	0.784	Download
4	5o31L	0.46	6.24	0.061	0.800	Download
5	5gupl	0.45	6.38	0.042	0.804	Download
6	3rkoN	0.45	6.17	0.029	0.800	Download
7	4v00A	0.44	6.08	0.041	0.740	Download
8	6nbqD	0.44	6.28	0.026	0.772	Download
9	6cfwH	0.44	6.21	0.034	0.764	Download
10	1tubA	0.43	5.80	0.058	0.716	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003774	0.02	motor activity
GO:0035639	0.01	purine ribonucleoside triphosphate binding
GO:0032555	0.01	purine ribonucleotide binding
GO:0032550	0.01	purine ribonucleoside binding
GO:0016887	0.01	ATPase activity
GO:0005200	0.01	structural constituent of cytoskeleton
GO:0003777	0.01	microtubule motor activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.04	cellular process
GO:0044763	0.03	single-organism cellular process
GO:0007017	0.02	microtubule-based process
GO:2000060	0.01	positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:2000045	0.01	regulation of G1/S transition of mitotic cell cycle
GO:1903861	0.01	positive regulation of dendrite extension
GO:1902533	0.01	positive regulation of intracellular signal transduction
GO:1902414	0.01	protein localization to cell junction
GO:1900101	0.01	regulation of endoplasmic reticulum unfolded protein response
GO:0090557	0.01	establishment of endothelial intestinal barrier

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044430	0.04	cytoskeletal part
GO:0005874	0.02	microtubule
GO:0005881	0.01	cytoplasmic microtubule
GO:0005876	0.01	spindle microtubule
GO:0005871	0.01	kinesin complex
GO:0005856	0.01	cytoskeleton
GO:0005816	0.01	spindle pole body
GO:0000930	0.01	gamma-tubulin complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]