MetaGO result for job id PF12675

User Input

>UniRef100_A0A1G1GEL1/5-141 (137 residues)
IKKILAPCGLNCSKCQAYSEGDIKKHATELKNLLGSFDIYADRFAKFLPVFGNYPAFKEL
LNQFSKANCRGCRQGDCKYPNCGVASCYKSKGVDFCFQCPDFPCTKTNFDPNLHQRWIKM
NQRMKEIGVEAYYEETK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4a01A	0.51	4.63	0.051	0.818	Download
2	2c9kA	0.51	4.65	0.056	0.847	Download
3	3mk7A	0.51	4.84	0.055	0.876	Download
4	2ks9A1	0.50	4.57	0.031	0.788	Download
5	4xydA	0.50	4.80	0.048	0.869	Download
6	3eb7A1	0.49	4.95	0.086	0.861	Download
7	1dlcA1	0.48	4.95	0.047	0.847	Download
8	2ziyA	0.47	5.09	0.029	0.825	Download
9	1i5pA	0.47	4.64	0.061	0.781	Download
10	1l9hA	0.46	4.65	0.030	0.781	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0031624	0.17	ubiquitin conjugating enzyme binding
GO:0061630	0.16	ubiquitin protein ligase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.26	cellular process
GO:0042787	0.08	protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0032436	0.08	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0000209	0.08	protein polyubiquitination
GO:0051704	0.03	multi-organism process
GO:0048646	0.03	anatomical structure formation involved in morphogenesis
GO:0043934	0.03	sporulation
GO:0030154	0.03	cell differentiation
GO:0006950	0.03	response to stress

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070469	0.02	respiratory chain
GO:0000151	0.02	ubiquitin ligase complex
GO:0016021	0.01	integral component of membrane
GO:0005886	0.01	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]