MetaGO result for job id PF11808

User Input

>UniRef100_A6D733/18-186 (169 residues)
YTPWIVVGWIFGYMPWLLLVATVLQLIWHLHNQLRLSAWLWDEKRLTPPSGTGNWESLFN
GIYRLQQRQRRKRKELTNLIRRFKNGAESLPDAVVVFRSEGNIVWCNKLAQHLLGFRWPD
DSGQPISNLIRTPDFIKYLNKQDFSEPLEMRSPLNVERMLELRIVPYTE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4qjyA	0.48	5.21	0.032	0.828	Download
2	1h2xA4	0.46	4.64	0.076	0.734	Download
3	5mpbZ4	0.46	4.78	0.031	0.740	Download
4	4cr2Z	0.45	4.63	0.055	0.716	Download
5	4adyA	0.43	4.10	0.046	0.639	Download
6	1nc5A	0.43	5.48	0.064	0.775	Download
7	1yr2A1	0.40	5.47	0.061	0.722	Download
8	3c87A2	0.39	5.03	0.059	0.669	Download
9	2ecfA2	0.39	5.29	0.030	0.692	Download
10	2bklB	0.39	5.68	0.049	0.734	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.98	catalytic activity
GO:0004871	0.64	signal transducer activity
GO:0016772	0.46	transferase activity, transferring phosphorus-containing groups
GO:0016773	0.37	phosphotransferase activity, alcohol group as acceptor
GO:0016775	0.36	phosphotransferase activity, nitrogenous group as acceptor
GO:0016301	0.36	kinase activity
GO:0004872	0.35	receptor activity
GO:0004673	0.35	protein histidine kinase activity
GO:0000155	0.32	phosphorelay sensor kinase activity
GO:0016787	0.23	hydrolase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.86	metabolic process
GO:0065007	0.59	biological regulation
GO:0009987	0.59	cellular process
GO:0050789	0.54	regulation of biological process
GO:0050794	0.49	regulation of cellular process
GO:0044237	0.41	cellular metabolic process
GO:0071704	0.36	organic substance metabolic process
GO:0044238	0.26	primary metabolic process
GO:0007165	0.16	signal transduction
GO:0043170	0.13	macromolecule metabolic process
GO:0000160	0.13	phosphorelay signal transduction system
GO:0006793	0.12	phosphorus metabolic process
GO:0006810	0.11	transport
GO:0006796	0.11	phosphate-containing compound metabolic process
GO:0044699	0.09	single-organism process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.99	cell part
GO:0005886	0.71	plasma membrane
GO:0005829	0.09	cytosol
GO:0016021	0.07	integral component of membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]