MetaGO result for job id PF11748

User Input

>k87_10653413_4_1/1-200 (200 residues)
MAEGFLGRWSQRKQALREGKPVEEPPAPAAAPPVPQAAARPQPAAEPVAAPEVVEAPPAP
TMEDVQTLTPQSDFRRYVAGDVDPAVKHAAMRKLFSDPHFNVMDGLDIYIDDYNTPNPMP
ASMLRKMASAHFLGLVEDEKKTPPAAAQPAQASLPAHSEPEPAAPERHATEPDETPHHDD
PDLRLQQDHASGPQGSGRGA

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5oybA	0.47	5.17	0.044	0.755	Download
2	3hq2B	0.46	5.07	0.040	0.760	Download
3	2jg0A	0.46	5.38	0.063	0.785	Download
4	5z1fA	0.46	5.14	0.094	0.760	Download
5	5d06A3	0.46	4.94	0.031	0.730	Download
6	1wgzA2	0.45	4.97	0.051	0.750	Download
7	1v7vA	0.39	5.38	0.070	0.665	Download
8	2z07B	0.35	5.28	0.104	0.585	Download
9	1rqgA	0.35	5.14	0.043	0.570	Download
10	1w07B	0.34	6.16	0.060	0.660	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0070011	0.18	peptidase activity, acting on L-amino acid peptides
GO:0004843	0.17	thiol-dependent ubiquitin-specific protease activity
GO:0004555	0.01	alpha,alpha-trehalase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006508	0.10	proteolysis
GO:0016579	0.08	protein deubiquitination
GO:0071474	0.01	cellular hyperosmotic response
GO:0006974	0.01	cellular response to DNA damage stimulus
GO:0005993	0.01	trehalose catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0030288	0.01	outer membrane-bounded periplasmic space
GO:0019773	0.01	proteasome core complex, alpha-subunit complex
GO:0005839	0.01	proteasome core complex
GO:0000502	0.01	proteasome complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]