MetaGO result for job id PF10691

User Input

>51340298/1-126 (126 residues)
EGSSVMSATATATPPNRKADDPEVALMLKVKRGDQRAFTELVERYWTQIFGRFFRRLGDR
QEAEDLAQDVFLRLYRYRDRYQPRAKFATWLFHISQNVARNARRSRRRRPCVRLGALAPE
EGEGLT

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5wuqA	0.72	2.18	0.299	0.849	Download
2	4cxfA	0.69	2.42	0.257	0.825	Download
3	3vdoA	0.62	2.92	0.184	0.754	Download
4	1or7A1	0.61	2.05	0.243	0.706	Download
5	1n4mA	0.61	2.99	0.067	0.833	Download
6	4eljA3	0.60	3.07	0.036	0.833	Download
7	2q1zA	0.60	3.49	0.234	0.778	Download
8	2o7gB	0.58	2.20	0.236	0.682	Download
9	1ad6A	0.55	3.79	0.102	0.833	Download
10	3n0rA1	0.55	2.73	0.079	0.706	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0016987	0.43	sigma factor activity
GO:0003677	0.02	DNA binding
GO:0003700	0.01	transcription factor activity, sequence-specific DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0050794	0.09	regulation of cellular process
GO:0080090	0.07	regulation of primary metabolic process
GO:0010556	0.07	regulation of macromolecule biosynthetic process
GO:0006355	0.06	regulation of transcription, DNA-templated
GO:0006352	0.06	DNA-templated transcription, initiation
GO:1902201	0.01	negative regulation of bacterial-type flagellum-dependent cell motility
GO:1900378	0.01	positive regulation of secondary metabolite biosynthetic process
GO:0097533	0.01	cellular stress response to acid chemical
GO:0090034	0.01	regulation of chaperone-mediated protein complex assembly
GO:0052572	0.01	response to host immune response

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005886	0.01	plasma membrane
GO:0005622	0.01	intracellular
GO:0005618	0.01	cell wall

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]