MetaGO result for job id PF09977

User Input

>k87_10365443_1_1/1-145 (145 residues)
LAVDVGVMYNTRAELQRSADAAALAAASELGDFINGDPLEDARVTAAQFAAVNKVRGQGV
DLAGQDVVFGRASLDEGSGKYVFEETEVFPNAVRVSVRRTEGSPSGPVGLFFANVFGISS
SNIAARATAVLTPRDIALVLDLSTS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2nxxE	0.42	5.28	0.048	0.793	Download
2	3p9dB2	0.42	5.00	0.074	0.738	Download
3	3p9dC2	0.42	5.07	0.094	0.738	Download
4	3lvtA	0.41	5.05	0.054	0.724	Download
5	1xvpD	0.41	5.61	0.080	0.814	Download
6	1pq6B	0.41	5.89	0.037	0.862	Download
7	1q3rA2	0.41	5.09	0.092	0.738	Download
8	1we3F1	0.41	5.30	0.071	0.752	Download
9	1n83A	0.40	5.57	0.047	0.779	Download
10	2ynjA2	0.40	5.01	0.066	0.710	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046914	0.05	transition metal ion binding
GO:0038023	0.04	signaling receptor activity
GO:0003677	0.04	DNA binding
GO:0098531	0.03	transcription factor activity, direct ligand regulated sequence-specific DNA binding
GO:0000981	0.03	RNA polymerase II transcription factor activity, sequence-specific DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071383	0.04	cellular response to steroid hormone stimulus
GO:0009755	0.04	hormone-mediated signaling pathway
GO:0045893	0.02	positive regulation of transcription, DNA-templated
GO:0006357	0.02	regulation of transcription from RNA polymerase II promoter
GO:0006352	0.02	DNA-templated transcription, initiation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005654	0.01	nucleoplasm
GO:0005634	0.01	nucleus
GO:0000790	0.01	nuclear chromatin

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]