MetaGO result for job id PF09550

User Input

>UniRef100_F7QLD9/1-64 (64 residues)
MTPFPWEEAIGFGLGVLRLPPEQFWRMTPRELACAVAAVRGSAGAPMDRAGLDALMQAFP
DRQE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2cwoA	0.60	3.44	0.094	0.938	Download
2	6agiA	0.57	2.98	0.085	0.891	Download
3	5msmA	0.56	2.88	0.071	0.875	Download
4	4nscA1	0.55	3.27	0.085	0.859	Download
5	2a3sA	0.55	2.83	0.071	0.844	Download
6	2mbfA	0.51	3.19	0.121	0.875	Download
7	2hdcA	0.48	3.57	0.035	0.875	Download
8	1kq8A	0.47	3.27	0.075	0.828	Download
9	1dmoA	0.45	3.19	0.074	0.750	Download
10	1pcxA	0.43	3.46	0.033	0.797	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0043169	0.03	cation binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:1901841	0.01	regulation of high voltage-gated calcium channel activity
GO:1901339	0.01	regulation of store-operated calcium channel activity
GO:0060316	0.01	positive regulation of ryanodine-sensitive calcium-release channel activity
GO:0055117	0.01	regulation of cardiac muscle contraction
GO:0051561	0.01	positive regulation of mitochondrial calcium ion concentration
GO:0051412	0.01	response to corticosterone
GO:0051343	0.01	positive regulation of cyclic-nucleotide phosphodiesterase activity
GO:0051260	0.01	protein homooligomerization
GO:0051000	0.01	positive regulation of nitric-oxide synthase activity
GO:0046777	0.01	protein autophosphorylation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005856	0.02	cytoskeleton
GO:0070062	0.01	extracellular exosome
GO:0044450	0.01	microtubule organizing center part
GO:0043005	0.01	neuron projection
GO:0034704	0.01	calcium channel complex
GO:0030426	0.01	growth cone
GO:0030017	0.01	sarcomere
GO:0008076	0.01	voltage-gated potassium channel complex
GO:0005876	0.01	spindle microtubule
GO:0005819	0.01	spindle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]