MetaGO result for job id PF09489

User Input

>k87_3194956_1_1/8-56 (49 residues)
VSQSKSQLLPIALAAILGLIIIYIAGHAQSQMLHEAAHDVRHATGFPCH

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5xsdL	0.78	1.72	0.082	1.000	Download
2	4ut1A	0.76	1.34	0.061	0.918	Download
3	2bkpA	0.76	1.75	0.082	0.980	Download
4	3lewA	0.76	1.83	0.082	1.000	Download
5	1sumB	0.75	1.40	0.083	0.980	Download
6	4l7tA	0.72	2.04	0.041	1.000	Download
7	3jq1B2	0.66	2.12	0.102	0.918	Download
8	3snxA	0.65	2.26	0.106	0.959	Download
9	3at7A	0.57	2.30	0.130	0.939	Download
10	2wssA	0.56	2.40	0.064	0.878	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901677	0.05	phosphate transmembrane transporter activity
GO:0046983	0.05	protein dimerization activity
GO:0042802	0.05	identical protein binding
GO:0015296	0.05	anion:cation symporter activity
GO:0015114	0.05	phosphate ion transmembrane transporter activity
GO:0015081	0.05	sodium ion transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:2000185	0.04	regulation of phosphate transmembrane transport
GO:1903796	0.04	negative regulation of inorganic anion transmembrane transport
GO:0098662	0.04	inorganic cation transmembrane transport
GO:0072502	0.04	cellular trivalent inorganic anion homeostasis
GO:0055062	0.04	phosphate ion homeostasis
GO:0019220	0.04	regulation of phosphate metabolic process
GO:0010563	0.04	negative regulation of phosphorus metabolic process
GO:0006814	0.04	sodium ion transport
GO:0070925	0.02	organelle assembly
GO:0070887	0.02	cellular response to chemical stimulus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0019031	0.01	viral envelope
GO:0009424	0.01	bacterial-type flagellum hook
GO:0009288	0.01	bacterial-type flagellum

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]