MetaGO result for job id PF08523

User Input

>UniRef100_T1GBR9/1-78 (78 residues)
MSDWDTVTVLRKKAPKASTLKTESAVNQARRTGVAVATEQKYGAGTNKQHIATKNTAKLD
RETEELRHSKISLDVGKL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1t5jA	0.52	3.43	0.087	0.885	Download
2	6d0jA	0.51	3.79	0.055	0.897	Download
3	5n1qB	0.51	3.51	0.087	0.885	Download
4	6fcxA	0.51	3.60	0.059	0.833	Download
5	3fdgB	0.50	3.57	0.053	0.859	Download
6	5a8rB	0.50	3.71	0.085	0.910	Download
7	6g1pA	0.50	3.88	0.068	0.936	Download
8	1yn9B	0.50	3.28	0.045	0.833	Download
9	2fozA	0.50	3.90	0.081	0.936	Download
10	2c46B	0.49	3.55	0.045	0.859	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003713	0.29	transcription coactivator activity
GO:0030674	0.02	protein binding, bridging
GO:0016799	0.02	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0044822	0.01	poly(A) RNA binding
GO:0008168	0.01	methyltransferase activity
GO:0004402	0.01	histone acetyltransferase activity
GO:0003700	0.01	transcription factor activity, sequence-specific DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.08	biological regulation
GO:0006355	0.07	regulation of transcription, DNA-templated
GO:0045893	0.06	positive regulation of transcription, DNA-templated
GO:0009987	0.05	cellular process
GO:0071941	0.02	nitrogen cycle metabolic process
GO:0048813	0.02	dendrite morphogenesis
GO:0045944	0.02	positive regulation of transcription from RNA polymerase II promoter
GO:0007424	0.02	open tracheal system development
GO:0007417	0.02	central nervous system development
GO:0006464	0.02	cellular protein modification process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005634	0.03	nucleus
GO:0005737	0.02	cytoplasm
GO:0070062	0.01	extracellular exosome
GO:0005730	0.01	nucleolus
GO:0005669	0.01	transcription factor TFIID complex
GO:0005654	0.01	nucleoplasm

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]