MetaGO result for job id PF08409

User Input

>UniRef100_UPI000522A5FB/75-147 (73 residues)
TGPPAFTEVDNPASFADSLFVRAINYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSVSD
WRIIALAALWFCL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1tffA	0.55	3.29	0.075	0.890	Download
2	5k3gA2	0.55	3.79	0.057	0.918	Download
3	3b98A2	0.54	3.65	0.060	0.918	Download
4	2vn0A	0.54	3.64	0.029	0.931	Download
5	2uxwA	0.54	3.63	0.057	0.863	Download
6	3e6iA	0.54	3.70	0.029	0.931	Download
7	3daxA3	0.53	3.39	0.134	0.904	Download
8	4r1zA2	0.53	3.64	0.057	0.931	Download
9	3fhdA	0.53	3.78	0.097	0.945	Download
10	1tqnA3	0.52	3.52	0.060	0.877	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.22	heterocyclic compound binding
GO:0097159	0.22	organic cyclic compound binding
GO:0046914	0.06	transition metal ion binding
GO:0046906	0.05	tetrapyrrole binding
GO:0003700	0.05	transcription factor activity, sequence-specific DNA binding
GO:0003824	0.04	catalytic activity
GO:0098772	0.01	molecular function regulator
GO:0097367	0.01	carbohydrate derivative binding
GO:0019899	0.01	enzyme binding
GO:0017111	0.01	nucleoside-triphosphatase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.96	biological regulation
GO:0044699	0.68	single-organism process
GO:0050789	0.67	regulation of biological process
GO:0009987	0.40	cellular process
GO:0050794	0.37	regulation of cellular process
GO:0019222	0.36	regulation of metabolic process
GO:0060255	0.34	regulation of macromolecule metabolic process
GO:0008152	0.26	metabolic process
GO:0010468	0.24	regulation of gene expression
GO:0080090	0.14	regulation of primary metabolic process
GO:0031323	0.14	regulation of cellular metabolic process
GO:0044763	0.11	single-organism cellular process
GO:2000112	0.09	regulation of cellular macromolecule biosynthetic process
GO:0019219	0.09	regulation of nucleobase-containing compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0043231	0.99	intracellular membrane-bounded organelle
GO:0005634	0.81	nucleus
GO:0044422	0.26	organelle part
GO:0044446	0.25	intracellular organelle part
GO:0016020	0.22	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]