MetaGO result for job id PF07219

User Input

>UniRef100_UPI00099200F9/1-399 (399 residues)
MFRALFLMLVLLGGLIGGPYLSGKQGYVLIQTAGYNIEMSITMLVVFFVILMAVVYLIEW
VITRFFRLSSNTYGWFSRRKRLKAQRQTLEGLVKMNEGDYSKAEKLIGKNAKHSDEPVLN
LIKAAEAAQNRGDDFAANRYLIEATDLAGTDSLIVEIARTRILLQQNKLPAARSSVDSLL
EMTSRNKEVLKLAVKIYLKSNAFHALDKILDQIEKAGLYSSEEFTALQRKVEDGLLDEKM
NEEGVDGLLRWWDEQPRKRRNDLYVKVGLIRRLLDSDDHESAYALAIEALKKAETGSEIN
TALCAQITRLQPEDNSKLLKLLEKRVKQANDKDCCCVNRALGYLYVRNDNFAKAADVFKK
VLENKASLQGNDITMAGYVFEQAGELELAQKVRAEGLRS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5gm6G	0.60	5.42	0.093	0.855	Download
2	4m57A	0.59	4.81	0.074	0.779	Download
3	6n1zA	0.59	5.56	0.063	0.852	Download
4	1wa5C	0.58	5.85	0.090	0.852	Download
5	6q82A	0.58	5.54	0.053	0.832	Download
6	4c0oA	0.58	5.41	0.049	0.832	Download
7	1qgkA	0.57	5.24	0.063	0.807	Download
8	3ea5B	0.57	5.87	0.070	0.840	Download
9	1u6gC	0.57	5.64	0.072	0.830	Download
10	6ez8A	0.56	5.54	0.091	0.825	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0019899	0.03	enzyme binding
GO:0017016	0.02	Ras GTPase binding
GO:0005052	0.01	peroxisome matrix targeting signal-1 binding
GO:0000993	0.01	RNA polymerase II core binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.06	cellular process
GO:0006886	0.03	intracellular protein transport
GO:0071704	0.02	organic substance metabolic process
GO:0051168	0.02	nuclear export
GO:0044237	0.02	cellular metabolic process
GO:2000636	0.01	positive regulation of primary miRNA processing
GO:2000630	0.01	positive regulation of miRNA metabolic process
GO:2000095	0.01	regulation of Wnt signaling pathway, planar cell polarity pathway
GO:1903912	0.01	negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
GO:1903047	0.01	mitotic cell cycle process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0031965	0.01	nuclear membrane
GO:0015030	0.01	Cajal body
GO:0005730	0.01	nucleolus
GO:0005654	0.01	nucleoplasm
GO:0005642	0.01	annulate lamellae
GO:0005635	0.01	nuclear envelope
GO:0000776	0.01	kinetochore

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]