MetaGO result for job id PF07195

User Input

>UniRef100_A0A0E3VWH2/2-366 (365 residues)
QASIVQVSSGSYEMVLTGTADAADITYSSTSGDDILSKLGVTDSSGAFTDVLQAAQSAEF
TLDGIAMTRDTNDISDVLTGVTFNLLQATPDGTSLNISIETDTSQIQSALETFVTNYNAF
RDEVIAQQAAGTDGTASSSAVLFGDGTMRNIMDALQNSLNSTVRGLTMADLGLSFNENNE
LELDTSTLSDVLSTNLSGVTKLLSAQTTTSSSQLSVVNTGTSPQSFTLDLTVDSDGNLTS
ASVGGDSSLFTVSGTTIIGASGSIYAGMAFTYSGSTSQSITVTSTSGLATQLYQLAKNYS
SSSGALQTLITNLTTRDDDLQQKVDDINSAASTLQSQLQTQYAKYQAAIESANSTLTYLK
ALLNS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1b25A	0.39	6.68	0.036	0.652	Download
2	2cse1	0.39	6.17	0.057	0.619	Download
3	5fnoA	0.39	6.70	0.042	0.641	Download
4	2o1xB	0.39	6.80	0.052	0.657	Download
5	3ayfA	0.39	6.57	0.034	0.619	Download
6	5ncog	0.39	5.87	0.076	0.578	Download
7	5oynA	0.39	6.64	0.079	0.647	Download
8	2vdcA	0.39	6.73	0.041	0.647	Download
9	6ns2A	0.39	6.92	0.046	0.644	Download
10	2zqpY	0.39	5.87	0.044	0.578	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005198	0.56	structural molecule activity
GO:0003824	0.16	catalytic activity
GO:0043169	0.06	cation binding
GO:0016491	0.04	oxidoreductase activity
GO:0016701	0.03	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
GO:0004871	0.02	signal transducer activity
GO:0042802	0.01	identical protein binding
GO:0022892	0.01	substrate-specific transporter activity
GO:0022857	0.01	transmembrane transporter activity
GO:0016788	0.01	hydrolase activity, acting on ester bonds

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.97	single-organism process
GO:0009987	0.84	cellular process
GO:0040011	0.77	locomotion
GO:0044763	0.71	single-organism cellular process
GO:0071973	0.37	bacterial-type flagellum-dependent cell motility
GO:0008152	0.20	metabolic process
GO:0044710	0.11	single-organism metabolic process
GO:0065007	0.03	biological regulation
GO:0050789	0.03	regulation of biological process
GO:0006935	0.03	chemotaxis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044461	0.72	bacterial-type flagellum part
GO:0016020	0.53	membrane
GO:0005886	0.37	plasma membrane
GO:0009424	0.05	bacterial-type flagellum hook

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]