MetaGO result for job id PF06743

User Input

>58724377/1-65 (65 residues)
LIKGVEVLERTRKITTVVFDKTGTLTKGDMALTATEAGTGTDGAELLRRAGAVEADSEHP
IGQAI

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6giiA	0.47	3.55	0.035	0.846	Download
2	5hdiA	0.46	3.61	0.111	0.800	Download
3	4l36A2	0.46	3.65	0.036	0.785	Download
4	6eqoA3	0.46	3.24	0.117	0.800	Download
5	5nwsA	0.46	3.81	0.085	0.877	Download
6	3omeA	0.46	3.42	0.071	0.754	Download
7	2zl3N	0.46	3.71	0.033	0.862	Download
8	4yzrA	0.46	3.95	0.100	0.877	Download
9	1jipA	0.45	4.01	0.051	0.831	Download
10	3hmkB2	0.45	3.75	0.088	0.800	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0019829	0.28	cation-transporting ATPase activity
GO:0046873	0.23	metal ion transmembrane transporter activity
GO:0046915	0.16	transition metal ion transmembrane transporter activity
GO:0015662	0.13	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
GO:0043682	0.07	copper-transporting ATPase activity
GO:0046914	0.05	transition metal ion binding
GO:0046906	0.05	tetrapyrrole binding
GO:0016491	0.03	oxidoreductase activity
GO:0015086	0.01	cadmium ion transmembrane transporter activity
GO:0008556	0.01	potassium-transporting ATPase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.30	single-organism process
GO:0006812	0.07	cation transport
GO:0055065	0.06	metal ion homeostasis
GO:0030001	0.06	metal ion transport
GO:0044710	0.05	single-organism metabolic process
GO:0006875	0.05	cellular metal ion homeostasis
GO:0098662	0.04	inorganic cation transmembrane transport
GO:0006878	0.03	cellular copper ion homeostasis
GO:0006825	0.03	copper ion transport
GO:0060003	0.02	copper ion export

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005887	0.02	integral component of plasma membrane
GO:0031090	0.01	organelle membrane
GO:0005789	0.01	endoplasmic reticulum membrane
GO:0005783	0.01	endoplasmic reticulum

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]