MetaGO result for job id PF05717

User Input

>93079168/1-89 (89 residues)
MGRSREEALAAFATAFRDYARSYPGRYQLTLTPPEPLDDEALAVGRRANAAFEAVIRSFG
LSGSEAVHLGRAVRSAIHGFIGLEARYSL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3rrwA	0.63	2.73	0.111	0.876	Download
2	1bgpA2	0.61	3.08	0.084	0.910	Download
3	1we3F	0.61	3.57	0.071	0.921	Download
4	2vcfX	0.61	2.67	0.120	0.820	Download
5	3hdlA1	0.60	2.88	0.073	0.888	Download
6	1qgjA	0.60	3.01	0.111	0.888	Download
7	2cepA	0.60	2.71	0.117	0.832	Download
8	1qo4A	0.60	3.04	0.085	0.888	Download
9	1schA	0.59	2.87	0.123	0.876	Download
10	2ynjA2	0.59	3.46	0.082	0.910	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003700	0.24	transcription factor activity, sequence-specific DNA binding
GO:1901363	0.18	heterocyclic compound binding
GO:0097159	0.18	organic cyclic compound binding
GO:0000976	0.09	transcription regulatory region sequence-specific DNA binding
GO:0043169	0.04	cation binding
GO:0020037	0.02	heme binding
GO:0004601	0.02	peroxidase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006355	0.13	regulation of transcription, DNA-templated
GO:0098869	0.02	cellular oxidant detoxification
GO:0055114	0.02	oxidation-reduction process
GO:0044248	0.02	cellular catabolic process
GO:0042743	0.02	hydrogen peroxide metabolic process
GO:0006979	0.02	response to oxidative stress

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005576	0.03	extracellular region
GO:0005886	0.01	plasma membrane
GO:0005829	0.01	cytosol

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]