MetaGO result for job id PF05676

User Input

>UniRef100_A0A061QUP0/1-67 (67 residues)
TQEEMDAAKLPLHWRDFCAHLLIPLNKCRHENFYMPWACHHERHAYEKCQYKDWVLRVQK
MDKIRAE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3dlaD	0.58	2.94	0.078	0.955	Download
2	5n4aA	0.56	3.18	0.032	0.881	Download
3	6gym2	0.56	3.40	0.065	0.895	Download
4	6emyA1	0.56	3.28	0.061	0.955	Download
5	4kjsA	0.56	2.75	0.111	0.806	Download
6	3l0mA	0.55	2.94	0.030	0.851	Download
7	3q15A	0.54	3.08	0.062	0.836	Download
8	5c9eA	0.54	3.28	0.078	0.940	Download
9	3ilvA	0.53	3.28	0.063	0.910	Download
10	1xngB	0.48	3.16	0.046	0.821	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0000166	0.33	nucleotide binding
GO:0016491	0.22	oxidoreductase activity
GO:0052890	0.05	oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor
GO:0050660	0.05	flavin adenine dinucleotide binding
GO:0009055	0.05	electron carrier activity
GO:0003995	0.05	acyl-CoA dehydrogenase activity
GO:0000062	0.05	fatty-acyl-CoA binding
GO:0035639	0.03	purine ribonucleoside triphosphate binding
GO:0032559	0.03	adenyl ribonucleotide binding
GO:0032550	0.03	purine ribonucleoside binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044237	0.17	cellular metabolic process
GO:0044710	0.08	single-organism metabolic process
GO:0044763	0.07	single-organism cellular process
GO:0044281	0.05	small molecule metabolic process
GO:0044249	0.05	cellular biosynthetic process
GO:0071704	0.04	organic substance metabolic process
GO:0044238	0.04	primary metabolic process
GO:0055114	0.02	oxidation-reduction process
GO:0019674	0.02	NAD metabolic process
GO:0019359	0.02	nicotinamide nucleotide biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005747	0.04	mitochondrial respiratory chain complex I
GO:0005739	0.03	mitochondrion
GO:0031966	0.02	mitochondrial membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]