MetaGO result for job id PF05071

User Input

>UniRef100_UPI0007B9CEBD/1-222 (222 residues)
MAEYANLVRRAAGQLTGHGGVRGFLLQLFRVNDIKTGALVGIDKYGNKYYEDNRYFFGRH
RWVIYTTEMNGKNTLWDVDGSMVPAEWHRWLHCMTDDPPTTHPPERVNDIKTGALVGIDK
YGNKYYEDNRYFFGRHRWVIYTTEMNGKNTLWDVDGSMVPAEWHRWLHCMTDDPPTTHPP
EPKKFLAKVHQFNNSGTLNCYVPYSTTRKKIHEWVPPKAGEK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3ddrA	0.46	6.13	0.038	0.838	Download
2	5ze4A	0.45	5.86	0.040	0.793	Download
3	3v89A2	0.45	5.34	0.057	0.725	Download
4	5mzsA	0.44	5.61	0.047	0.739	Download
5	5fq6B	0.44	5.39	0.050	0.721	Download
6	1fepA	0.44	5.29	0.048	0.721	Download
7	1kmpA	0.42	5.50	0.023	0.703	Download
8	4aipA	0.42	6.03	0.051	0.761	Download
9	3qlbA	0.39	5.68	0.043	0.662	Download
10	2gskA	0.38	6.28	0.045	0.716	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046914	0.11	transition metal ion binding
GO:0008137	0.09	NADH dehydrogenase (ubiquinone) activity
GO:0060089	0.04	molecular transducer activity
GO:0050897	0.01	cobalt ion binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.13	single-organism process
GO:0055114	0.03	oxidation-reduction process
GO:0050896	0.03	response to stimulus
GO:0015688	0.03	iron chelate transport
GO:0006091	0.03	generation of precursor metabolites and energy
GO:0045333	0.02	cellular respiration
GO:0006979	0.02	response to oxidative stress
GO:0072593	0.01	reactive oxygen species metabolic process
GO:0061179	0.01	negative regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0044351	0.01	macropinocytosis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0009279	0.07	cell outer membrane
GO:0005747	0.01	mitochondrial respiratory chain complex I
GO:0005739	0.01	mitochondrion

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]