MetaGO result for job id PF04749

User Input

>UniRef100_P0CW97/10-150 (141 residues)
PHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGALYVLLAAIT
GCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYRELKHRGFDMSLGWAGN
VEKQQNQGGVAMGAPAFQGGM

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6em5n	0.44	4.54	0.054	0.723	Download
2	4gbyA	0.43	5.09	0.058	0.801	Download
3	6em3n	0.43	4.54	0.081	0.702	Download
4	2nyfA	0.43	4.65	0.041	0.738	Download
5	1gkmA	0.43	4.76	0.064	0.731	Download
6	4kjsA	0.43	4.79	0.037	0.731	Download
7	3nz4A3	0.40	5.12	0.026	0.716	Download
8	2pokA1	0.39	5.57	0.055	0.759	Download
9	2o78A2	0.39	4.78	0.082	0.674	Download
10	1w27A3	0.38	4.83	0.026	0.695	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0022892	0.58	substrate-specific transporter activity
GO:0003824	0.29	catalytic activity
GO:0022890	0.24	inorganic cation transmembrane transporter activity
GO:0046873	0.17	metal ion transmembrane transporter activity
GO:0072509	0.10	divalent inorganic cation transmembrane transporter activity
GO:0015085	0.09	calcium ion transmembrane transporter activity
GO:0005261	0.09	cation channel activity
GO:0005262	0.08	calcium channel activity
GO:0016491	0.04	oxidoreductase activity
GO:0051082	0.01	unfolded protein binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.96	cellular process
GO:0044699	0.93	single-organism process
GO:0044763	0.70	single-organism cellular process
GO:0008152	0.32	metabolic process
GO:0071704	0.18	organic substance metabolic process
GO:0044237	0.18	cellular metabolic process
GO:0065007	0.14	biological regulation
GO:0050896	0.14	response to stimulus
GO:0044710	0.12	single-organism metabolic process
GO:0051179	0.11	localization
GO:0006810	0.10	transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044424	0.96	intracellular part
GO:0044444	0.68	cytoplasmic part
GO:0043227	0.54	membrane-bounded organelle
GO:0043231	0.50	intracellular membrane-bounded organelle
GO:0016020	0.15	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]