MetaGO result for job id PF04577

User Input

>k87_2503485_2_1/74-392 (319 residues)
THEAGEVFITTLGQARIATPYAFIFNQSGVLFSDSYHNQDMVAMPIERMEHFIKVDLQMS
IKDDAFNVPANTVRFDWPPKQIEQPCLLLASPWCEGYHHWILETLPRLWALDEFEELREL
PVVIPAWVKQYHLDSLEAFGIEEDRILKFDGGTWDFDRLYVPSFLAPGGHSERQITWVRE
RLREVFDIKQTNPGDRRIYVSRRDAASRRLVNEDAILPLLKQSEFEIIAPGELTLTEQIT
KFSEASVIIGVAGSGLTNFAFAQPGCTLIEFHPADYVNLAYWFMASAVGHNYWFEIGQTV
NETQDFTIELERVEAALKA

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2p4eA	0.42	6.52	0.043	0.715	Download
2	1wmfA	0.42	6.44	0.036	0.709	Download
3	3afgA	0.41	6.61	0.040	0.705	Download
4	2ya0A	0.41	6.71	0.047	0.721	Download
5	3vtaA	0.41	6.47	0.028	0.683	Download
6	1p8jA	0.40	6.13	0.034	0.661	Download
7	2agsA	0.40	7.06	0.055	0.734	Download
8	3hjrA	0.40	6.46	0.042	0.683	Download
9	1z8lA	0.40	6.79	0.044	0.699	Download
10	1r64A	0.40	6.28	0.049	0.671	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0008194	0.29	UDP-glycosyltransferase activity
GO:0008375	0.11	acetylglucosaminyltransferase activity
GO:0008236	0.05	serine-type peptidase activity
GO:0004175	0.04	endopeptidase activity
GO:0097363	0.01	protein O-GlcNAc transferase activity
GO:0047517	0.01	1,4-beta-D-xylan synthase activity
GO:0016262	0.01	protein N-acetylglucosaminyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.35	metabolic process
GO:0019538	0.34	protein metabolic process
GO:0044763	0.08	single-organism cellular process
GO:0006493	0.06	protein O-linked glycosylation
GO:0035269	0.02	protein O-linked mannosylation
GO:0001764	0.02	neuron migration
GO:0097370	0.01	protein O-GlcNAcylation via threonine
GO:0060041	0.01	retina development in camera-type eye
GO:0048747	0.01	muscle fiber development
GO:0048354	0.01	mucilage biosynthetic process involved in seed coat development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005576	0.03	extracellular region
GO:0005783	0.02	endoplasmic reticulum
GO:1990667	0.01	PCSK9-AnxA2 complex
GO:1990666	0.01	PCSK9-LDLR complex
GO:0031232	0.01	extrinsic component of external side of plasma membrane
GO:0030134	0.01	ER to Golgi transport vesicle
GO:0005794	0.01	Golgi apparatus
GO:0005791	0.01	rough endoplasmic reticulum
GO:0005770	0.01	late endosome
GO:0005769	0.01	early endosome

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]