MetaGO result for job id PF04361

User Input

>UniRef100_A0A0W7U521/1-157 (157 residues)
MFDVLMYLFETYIHSDAEVMIDQDELTDELSRAGFHQDEIYKALGWLERLANLHDSERET
YVTCSAPSSMRIYAPQELDRLSAECRGFLLFLEQAKVLNAETREIVIERLLELDTPEIEL
DDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVLH

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3dsiA	0.52	3.77	0.055	0.739	Download
2	3w0lB	0.51	4.47	0.094	0.796	Download
3	4oqjA2	0.51	4.47	0.054	0.809	Download
4	5t2cAo	0.51	4.32	0.119	0.783	Download
5	1t3qB	0.51	4.32	0.046	0.802	Download
6	3qmzA	0.51	4.69	0.027	0.809	Download
7	4r20A	0.50	3.88	0.042	0.733	Download
8	5m1jA2	0.50	4.39	0.081	0.783	Download
9	1j5xA	0.50	4.34	0.056	0.783	Download
10	3j38A	0.50	4.29	0.090	0.764	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0020037	0.02	heme binding
GO:0016705	0.02	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005506	0.02	iron ion binding
GO:0004497	0.01	monooxygenase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0055114	0.02	oxidation-reduction process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0031090	0.01	organelle membrane
GO:0005789	0.01	endoplasmic reticulum membrane
GO:0005783	0.01	endoplasmic reticulum
GO:0005739	0.01	mitochondrion

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]