MetaGO result for job id PF04290

User Input

>k87_4399203_1_1/6-152 (147 residues)
EKLEETLLVALLASMTLLIGLQVFMRYVMEASLTWSEELARYLFIWATYIGVSYGVRKQA
HIRVTAFSDLLPDRGQIVVRILIHLVFGLFAALVIWEGTKLTAKIYGFGQTSSSLGVPMA
YVYAAPVVGFGLVVIRLIQHIVLDIAR

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3kfoA	0.55	3.87	0.092	0.803	Download
2	1zcjA2	0.53	4.16	0.104	0.789	Download
3	6iumB	0.52	4.16	0.074	0.775	Download
4	2x58A	0.51	4.09	0.088	0.775	Download
5	5zqzA	0.51	4.02	0.101	0.748	Download
6	3mogA	0.51	4.37	0.050	0.775	Download
7	3wiqA2	0.51	4.66	0.030	0.796	Download
8	2wtbA	0.50	4.33	0.033	0.775	Download
9	1wdlA	0.49	4.22	0.076	0.748	Download
10	1h54B2	0.48	4.60	0.070	0.775	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005215	0.17	transporter activity
GO:0022891	0.14	substrate-specific transmembrane transporter activity
GO:0015556	0.05	C4-dicarboxylate transmembrane transporter activity
GO:0016616	0.02	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0015144	0.01	carbohydrate transmembrane transporter activity
GO:0008381	0.01	mechanically-gated ion channel activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006810	0.12	transport
GO:0071702	0.08	organic substance transport
GO:0006820	0.06	anion transport
GO:0015740	0.05	C4-dicarboxylate transport
GO:0044255	0.02	cellular lipid metabolic process
GO:0032787	0.02	monocarboxylic acid metabolic process
GO:0080167	0.01	response to karrikin
GO:0050982	0.01	detection of mechanical stimulus
GO:0034219	0.01	carbohydrate transmembrane transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0016020	0.02	membrane
GO:0005886	0.01	plasma membrane
GO:0005829	0.01	cytosol
GO:0005777	0.01	peroxisome
GO:0005759	0.01	mitochondrial matrix
GO:0005739	0.01	mitochondrion
GO:0005730	0.01	nucleolus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]