MetaGO result for job id PF04246

User Input

>UniRef100_B5JX05/1-143 (143 residues)
MIEEQATVTAVEDDYAWVQTQRSTACDSCSAQKGCGTSTLGKVIGRQYTQVRALNSSGAQ
VGDEVMVGLAEDMLLKSSLAVYLVPIALMLMGGVLGDYWSAGNSLYAALASGLGLAFGFV
WIQWFSHKISHNERFQPVVLRVL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1nbwA	0.51	4.20	0.048	0.797	Download
2	6b8ha	0.51	4.15	0.083	0.769	Download
3	2ww9A	0.50	4.90	0.042	0.839	Download
4	2d0pA	0.50	4.37	0.048	0.804	Download
5	6rimA	0.50	4.69	0.066	0.846	Download
6	4m58A	0.50	4.37	0.038	0.776	Download
7	5lilA	0.50	4.18	0.090	0.755	Download
8	4hzuS	0.49	3.92	0.019	0.685	Download
9	5lstA	0.49	4.70	0.043	0.797	Download
10	5kbwA	0.49	3.87	0.060	0.692	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003700	0.24	transcription factor activity, sequence-specific DNA binding
GO:0071949	0.01	FAD binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0080090	0.07	regulation of primary metabolic process
GO:0010556	0.07	regulation of macromolecule biosynthetic process
GO:0032885	0.02	regulation of polysaccharide biosynthetic process
GO:0006355	0.02	regulation of transcription, DNA-templated
GO:0070189	0.01	kynurenine metabolic process
GO:0065002	0.01	intracellular protein transmembrane transport
GO:0055114	0.01	oxidation-reduction process
GO:0044550	0.01	secondary metabolite biosynthetic process
GO:0043640	0.01	benzoate catabolic process via hydroxylation
GO:0043420	0.01	anthranilate metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0016020	0.11	membrane
GO:0005886	0.04	plasma membrane
GO:0030176	0.01	integral component of endoplasmic reticulum membrane
GO:0005741	0.01	mitochondrial outer membrane
GO:0005622	0.01	intracellular

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]