MetaGO result for job id PF04120

User Input

>UniRef100_B0Y599/3-481 (479 residues)
VLSKPGTKADIHGVAPTQFIEKDGLAIDKPNATGYTPKSKPRLLDRWLDFVVRVSGSEPV
FFFILAGLLTWALLGIRYGTSDLWQVLISDIQAIVSYVFDSFLVRQQLNAYDEEMTVAAE
LQSRILSHRRMLAKLGLETDQKDPEKQARLQSIVARHQDAPGFSAELPTEKRFGRTITWF
SHLLGHLGTVALYWVGVFVWIGLGHREGYSNEWQLYMNSASSALMVFVFAFLANVRERHS
AYARSCLNAIFQVDATLEFRLRLLTGDNIDNDVVIIPAPKVSGVQRAIFYYADLVGTLVG
ITILLIMMTIWVAIGPLLHFDANWWLIIGTYAGLVGMNDGFVLRNLQARLRGFADLEFEK
VAVEDDKLFESVGQAMPIKEAAEKPGLTQRVSDAMNRVCAHEITVVAGFLTIVGLIAGAS
AMKWTMTGQLLCNVPPSLIESFFMIILITGHNSADDRKRMDLRNLYERRLHLLALVNNE

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5fvmA	0.36	7.14	0.037	0.589	Download
2	5a22A	0.36	7.20	0.051	0.593	Download
3	5xsyA	0.35	6.83	0.027	0.549	Download
4	4bqhA	0.34	7.26	0.041	0.559	Download
5	3zyvA	0.34	7.21	0.028	0.559	Download
6	1iduA	0.34	7.29	0.051	0.562	Download
7	2yqjA	0.32	7.37	0.053	0.534	Download
8	1dgjA2	0.31	7.40	0.036	0.518	Download
9	1jv3A1	0.31	7.08	0.055	0.495	Download
10	2i5kB	0.30	7.24	0.050	0.488	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005381	0.30	iron ion transmembrane transporter activity
GO:0005375	0.30	copper ion transmembrane transporter activity
GO:0052813	0.05	phosphatidylinositol bisphosphate kinase activity
GO:0052742	0.05	phosphatidylinositol kinase activity
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0035004	0.05	phosphatidylinositol 3-kinase activity
GO:0032559	0.05	adenyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0016307	0.05	phosphatidylinositol phosphate kinase activity
GO:0004672	0.02	protein kinase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0015680	0.13	intracellular copper ion transport
GO:0015677	0.13	copper ion import
GO:0006829	0.13	zinc II ion transport
GO:0000040	0.13	low-affinity iron ion transmembrane transport
GO:0046834	0.04	lipid phosphorylation
GO:0006661	0.04	phosphatidylinositol biosynthetic process
GO:0006464	0.03	cellular protein modification process
GO:1902531	0.02	regulation of intracellular signal transduction
GO:0050851	0.02	antigen receptor-mediated signaling pathway
GO:0048646	0.02	anatomical structure formation involved in morphogenesis

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005942	0.07	phosphatidylinositol 3-kinase complex
GO:0005886	0.06	plasma membrane
GO:0051286	0.01	cell tip
GO:0042629	0.01	mast cell granule
GO:0032153	0.01	cell division site
GO:0030027	0.01	lamellipodium
GO:0005943	0.01	phosphatidylinositol 3-kinase complex, class IA
GO:0005829	0.01	cytosol
GO:0005794	0.01	Golgi apparatus
GO:0005622	0.01	intracellular

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]