MetaGO result for job id PF04028

User Input

>k87_4920204_1_1/1-120 (120 residues)
YIAAFWHGRLLMAPTGWRKNVPLSVMISKHRDGELISRTVKHFGVSTIRGSTSRGGTKAL
RESLKAIKKGHNVAITPDGPRGPRMRVQIGIILLAKLSGAPIIPATYSVSRRKLLPSWDR

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1zu5B	0.67	3.34	0.052	0.925	Download
2	2og2A	0.66	3.48	0.076	0.942	Download
3	2q9bA	0.66	3.26	0.059	0.925	Download
4	3gr6D	0.65	3.56	0.061	0.958	Download
5	1vmaA	0.65	3.29	0.042	0.925	Download
6	2qioA	0.65	3.47	0.070	0.950	Download
7	6cy1A	0.65	3.35	0.034	0.925	Download
8	5b1yA	0.65	3.48	0.115	0.933	Download
9	2qy9A	0.65	3.39	0.051	0.925	Download
10	4nk4A	0.65	3.51	0.035	0.950	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0008374	0.29	O-acyltransferase activity
GO:0071617	0.28	lysophospholipid acyltransferase activity
GO:0042171	0.27	lysophosphatidic acid acyltransferase activity
GO:0016411	0.27	acylglycerol O-acyltransferase activity
GO:0005525	0.04	GTP binding
GO:0003924	0.03	GTPase activity
GO:0003841	0.02	1-acylglycerol-3-phosphate O-acyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044763	0.24	single-organism cellular process
GO:0008610	0.05	lipid biosynthetic process
GO:0006644	0.05	phospholipid metabolic process
GO:0045017	0.04	glycerolipid biosynthetic process
GO:0008654	0.04	phospholipid biosynthetic process
GO:0006650	0.04	glycerophospholipid metabolic process
GO:1902589	0.03	single-organism organelle organization
GO:0046474	0.03	glycerophospholipid biosynthetic process
GO:0030030	0.03	cell projection organization
GO:0006614	0.03	SRP-dependent cotranslational protein targeting to membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005886	0.02	plasma membrane
GO:0048500	0.01	signal recognition particle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]