MetaGO result for job id PF03699

User Input

>UniRef100_D9QQM0/5-907 (903 residues)
RRIIFIIVIAGLILGSLALLGINFYTDWLWFSSIEYLSVFKTIFFTNIWIKLGIMLFFTV
FVFINLLITKKEILDYKQREENVEYIDDPLADQRNSFLELVTSRNLTWVFLGVSILVSLL
FSSISSDVWRIVKEFLNSTPFNITDPIFNNDIGFYIFELPFYKFIYQLLTILLVVSGVLS
AVIYLFINSKQLLTRNITQGSRAKYHLSVLVALFMLLKAWGYLLSRYDLLYSTRGVAFGA
SYTDVNASLFALNVLAVLAALVAVFMIINIFTKNLKLVFGGIIVLLVASILLGSIYPQII
QQFNVEPNELTKERPYIKYNIQMTKEAYNLDEIEESPYPVQGKLRYEDIENNPETISNIR
LWDSRPLKSTYSQLQEMRLYYNFADIDIDRYEIDGEYRQVMLSPRELNQDQLPSRANTWI
NRKLKYTHGFGVAMNLANRVSPEGLPDFLIKNIPPKSETDLNITEPRIYYGEQTNNYVVA
NNQEQEFDYPMGDQNAYNTYQGSGGVQLDSIIKQLAFASRFSSAKMILNGDISSESRLLF
YRNIQQRVNKIAPFLSYDSDPYMVIGDDGKLYWMQDAYTTTDMYPYSEPYNNSLNYIRNS
VKVVIDAYTGETNFYIIDDSDPLVQTYSKIFPELFKPFAEMSDDLKNHIRYPEDLFKIQT
QLYSTYHMTNPTVFYNKEDLWKIPTEKLAGNTVEMQPYYTIMQLPEHKEEEFLLMQPFTP
NRKNNMISWLAARSDQEDYGKLLLYKFPKQRLIYGPMQIESRIDQNSTISRQLSLWDQKG
SRVIRGNLLVIPIEDSILYVEPIYLQSDQSDLPEMKRVIVSDGNRVVMARNLDLAFAKLF
EGEADAPDVPEEEIEQEIIGVQNLTERALELYNEAQTNLQEGNWTEYGEAIEELRSILED
LKS

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5u1sA	0.38	8.59	0.055	0.584	Download
2	5hb4B	0.37	8.82	0.043	0.586	Download
3	6mu1A	0.34	9.43	0.051	0.575	Download
4	6edoA	0.34	9.37	0.036	0.565	Download
5	1wxrA	0.32	9.04	0.034	0.525	Download
6	5yz0A	0.32	8.64	0.033	0.501	Download
7	5y81A	0.32	8.98	0.056	0.517	Download
8	3szeA	0.32	8.48	0.030	0.494	Download
9	6g2dC	0.32	8.56	0.049	0.497	Download
10	5j44A	0.32	9.14	0.049	0.522	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005351	0.06	sugar:proton symporter activity
GO:0008236	0.03	serine-type peptidase activity
GO:0004175	0.03	endopeptidase activity
GO:0042923	0.02	neuropeptide binding
GO:0015150	0.02	fucose transmembrane transporter activity
GO:0015147	0.02	L-arabinose transmembrane transporter activity
GO:0004930	0.02	G-protein coupled receptor activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.09	single-organism process
GO:0051704	0.03	multi-organism process
GO:0007268	0.03	chemical synaptic transmission
GO:0007218	0.03	neuropeptide signaling pathway
GO:0007187	0.03	G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0042882	0.02	L-arabinose transport
GO:0019538	0.02	protein metabolic process
GO:0015756	0.02	fucose transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005576	0.12	extracellular region
GO:0005618	0.03	cell wall
GO:0016020	0.02	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]