MetaGO result for job id PF02656

User Input

>k87_12389439_2_1/5-114 (110 residues)
RKQDSIRDHLANERTFLAWTRTSIGIMAFGFAIVKFSLFVKQVSPELNQEHAHPNKGYST
IIGIALVVVGSLVSMLSYFRYRDIQRQIDNTAYKNRSLVITVLTVFIFSM

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1r1kD	0.55	3.65	0.053	0.855	Download
2	2nxxE	0.54	3.78	0.096	0.855	Download
3	1xvpD	0.54	3.63	0.043	0.846	Download
4	3hvlB	0.54	3.64	0.065	0.836	Download
5	1n83A	0.53	3.71	0.043	0.846	Download
6	1xnxA	0.53	3.57	0.075	0.846	Download
7	6fzfA	0.53	3.96	0.043	0.846	Download
8	4nqaB	0.53	3.82	0.043	0.855	Download
9	1osvA	0.52	3.92	0.085	0.855	Download
10	2npaA	0.52	3.90	0.053	0.864	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046872	0.12	metal ion binding
GO:0046914	0.05	transition metal ion binding
GO:0003676	0.05	nucleic acid binding
GO:0038023	0.04	signaling receptor activity
GO:0003677	0.04	DNA binding
GO:0098531	0.03	transcription factor activity, direct ligand regulated sequence-specific DNA binding
GO:0000981	0.03	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003712	0.02	transcription cofactor activity
GO:0000822	0.02	inositol hexakisphosphate binding
GO:0030695	0.01	GTPase regulator activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.26	cellular process
GO:0044237	0.14	cellular metabolic process
GO:0071704	0.11	organic substance metabolic process
GO:0050896	0.09	response to stimulus
GO:0007165	0.06	signal transduction
GO:0071383	0.05	cellular response to steroid hormone stimulus
GO:0009755	0.05	hormone-mediated signaling pathway
GO:0006793	0.05	phosphorus metabolic process
GO:0042144	0.04	vacuole fusion, non-autophagic
GO:0006797	0.04	polyphosphate metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0033254	0.01	vacuolar transporter chaperone complex
GO:0005856	0.01	cytoskeleton
GO:0005783	0.01	endoplasmic reticulum
GO:0005654	0.01	nucleoplasm
GO:0005634	0.01	nucleus
GO:0000790	0.01	nuclear chromatin
GO:0000329	0.01	fungal-type vacuole membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]