MetaGO result for job id PF01169

User Input

>k87_1468645_27_1/3-181 (179 residues)
AFLSSTLLVALGEIGDKTQLLSLALVVRYRKPWPILAGVVVATLINHGLSVWFGDWLADA
IPADWLTWILGLSFIALGLWMLIPDQDEEIGDRYRFGPFLTSLVLFFIAEIGDKTQVATV
ALAVRFQEFWPVLLGTTTGMIAANLPVIWVAHRLASERFEIWAHRISAALFIAFGVWAL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2inrA	0.49	4.85	0.045	0.776	Download
2	2xkjE2	0.48	4.85	0.057	0.776	Download
3	6gauA2	0.48	4.77	0.064	0.765	Download
4	5npkb	0.48	4.87	0.051	0.782	Download
5	1zvuA3	0.48	4.80	0.064	0.771	Download
6	2wl2B2	0.48	4.94	0.051	0.788	Download
7	4z2cA	0.48	4.87	0.057	0.776	Download
8	5eixA2	0.48	4.94	0.076	0.782	Download
9	6ca8A	0.47	5.10	0.075	0.782	Download
10	4i3hA3	0.47	4.96	0.038	0.782	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0072509	0.12	divalent inorganic cation transmembrane transporter activity
GO:0046873	0.11	metal ion transmembrane transporter activity
GO:0061505	0.05	DNA topoisomerase II activity
GO:0035639	0.05	purine ribonucleoside triphosphate binding
GO:0032559	0.05	adenyl ribonucleotide binding
GO:0032550	0.05	purine ribonucleoside binding
GO:0008094	0.05	DNA-dependent ATPase activity
GO:0015095	0.02	magnesium ion transmembrane transporter activity
GO:0015085	0.02	calcium ion transmembrane transporter activity
GO:0005384	0.02	manganese ion transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.13,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.29	cellular process
GO:0044260	0.21	cellular macromolecule metabolic process
GO:0044238	0.19	primary metabolic process
GO:0016043	0.05	cellular component organization
GO:0071103	0.04	DNA conformation change
GO:0044763	0.04	single-organism cellular process
GO:0006260	0.04	DNA replication
GO:0006874	0.03	cellular calcium ion homeostasis
GO:0006816	0.03	calcium ion transport
GO:0006487	0.03	protein N-linked glycosylation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.08,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005694	0.04	chromosome
GO:0005794	0.02	Golgi apparatus
GO:0032588	0.01	trans-Golgi network membrane
GO:0019897	0.01	extrinsic component of plasma membrane
GO:0010008	0.01	endosome membrane
GO:0009330	0.01	DNA topoisomerase complex (ATP-hydrolyzing)
GO:0009295	0.01	nucleoid
GO:0005765	0.01	lysosomal membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.14,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. (2018) MetaGO: A Structure and Protein-Protein Interaction Network Based Pipeline for Automated Protein Function Annotations. Journal of Molecular Biology.

[back to server]