LOMETS results for example-D1

[Click result.zip to download all results on this page]

Input Sequence in FASTA format

>example-D1 (66 residues)
FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIYRYIVH
IDSTER

Predicted Secondary Structure

Sequence	20 40 60 \| \| \| FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIYRYIVHIDSTER
Prediction	CHHHHHHHCCCSSSSSSCCCCSSSSSSSSSCCCCSSSSSSCSCCCCCSCCSSSSSSSSSSSSSCCC
Conf.Score	957888765988999986996999999996787479997533568985557999888888753469
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 \| \| \| FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIYRYIVHIDSTER
Prediction	744414522444040304636414020212345023102313466454232010331133044268
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Contact and Distance Map Used in LOMETS

Contact Map

Distance Map

LOMETS threading is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact and distance maps, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map a color scale represents a distance of 1-20+ angstroms. No dot is close to the diagonal in the contact map, because LOMETS does not consider contacts for residue pairs separated by <4 residues.

Top 10 Templates Identified by LOMETS

Rank

PDB
Hit

RCSB
Link

CMO

MAE

ID1

ID2

Cov

Norm.
Zscore

Download
Alignment

                  20                  40                  60

                   |                   |                   |

Sec.Str.
Sol.Acc.
Seq

CHHHHHHHCCCSSSSSSCCCCSSSSSSSSSCCCCSSSSSSCSCCCCCSCCSSSSSSSSSSSSSCCC
744414522444040304636414020212345023102313466454232010331133044268
FVAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIYRYIVHIDSTER

4c8qE

4c8q

0.805

1.194

0.17

1.00

1.19

HHpred

PLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWVMQHHGRMLLSNNIAILVPGGK

5mkiA

5mki

0.846

1.087

0.24

0.23

0.95

2.22

SparksX

PLDALGKSINTNVTVYLKDGKLVKGRLKAYDLHMNVALENAKIESEKEFPMLVVRDNVLYVSL---

4c8qE

4c8q

0.805

1.194

0.17

1.00

1.27

HHsearch

PLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWVMQHHGRMLLSNNIAILVPGGK

5nrll

5nrl

0.893

1.099

0.24

1.00

1.38

MUSTER

LVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPASLQYINIRNTIRQIILPDS

5mqfe

5mqf

0.765

1.491

0.20

0.98

1.07

FFAS3D

-IKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDQLEQVYIRGSKIRFLILPD

5ganr

5gan

0.758

1.203

0.18

1.00

1.33

HHpred

STPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGQTVIRNSIISLEALDA

3swnA

3swn

0.866

1.169

0.17

1.00

2.17

SparksX

PLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTEKHSEMLLNGGMCMLIPGGK

3jb9G

3jb9

0.805

1.060

0.17

1.00

1.27

HHsearch

PLSVLQQAVHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMKDRFISKMFLRDGVVLVVRIPS

5mqfg

5mqf

0.852

1.104

0.21

1.00

1.28

MUSTER

LVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKVQLETLSIRNNIRYFILPDS

5nrll

5nrl

0.832

1.456

0.21

1.00

1.05

FFAS3D

LVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPNSLQYINIRGNTIRQIILPD

(a)	Templates are ranked in descending order of the following score: score(i,j)=conf(i)·Z(i,j)/Z₀(i)+seqid(i,j), where Z(i,j) is the Z-score of j-th template of i-th server; Z₀(i) is the Z-score cutoff for defining good/bad templates for the i-th server; conf(i) is the confidence of i-th server which is defined as the average TM-score to the natives of all predictions calculated from a large-scale benchmark test; and seqid(i,j) is the sequence identity to query of j-th template of i-th server. (See here for details)
(b)	PDB Hit is the PDB of the specific domain/chain aligned to the query.
(c)	RCSB Link is the RCSB PDB link of the full-length protein.
(d)	CMO is the contact map overlap score, calculated from the number of overlapping contacts between the predicted contact map and the contact map derived from the aligned template, then normalized by the number of predicted contacts.
(e)	MAE is the mean absolute error between the predicted distance map and the distance map derived from the aligned template.
(f)	ID1 is the number of template residues identical to query divided by the number of aligned residues.
(g)	ID2 is the number of template residues identical to query divided by the query sequence length.
(h)	Cov is equal to the number of aligned template residues divided by the query sequence length.
(i)	Norm. Zscore is the normalized Z-score of the threading alignments. A normalized Z-score ≥1 means a good alignment.
(j)	Download Alignment list the threading program used to identify the template provide the 3D structure of aligned regions of threading templates.
(k)	Sec.Str. is predicted secondary structure, with H, S and C representing helix, strand, and coil, respectively.
(l)	Sol.Acc. is predicted solvent accessibility, where values range from 0 (buried residue) to 8 (highly exposed residue)
(m)	Images of the top 10 PDB hits are listed below, together with the threading programs used to detect them:

4c8q
HHpred,HHsearch

5mki
SparksX

5nrl
MUSTER,FFAS3D

5mqf
FFAS3D

5gan
HHpred

3swn
SparksX

3jb9
HHsearch

5mqf
MUSTER

Full-Length Models

LOMETS uses L-BFGS to construct full-length models guided by the distance restraints predicted by DeepPotential and calculated from top detected templates.
By dragging your mouse on the images, you can rotate and zoom the structure.

Download Model 1

Download Model 2

Download Model 3

Download Model 4

Download Model 5

Proteins with similar structure

LOMETS uses the TM-align structural alignment program to match the first model to all structures in the PDB library.
This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e., the highest TM-score, to the predicted model.
Due to the structural similarity, these proteins often have similar functions to the target.

SpinHigh qual.White bkgd

Top 10 structural analogues in PDB (as identified by TM-align)

Rank	RCSB Link	TM-score	RMSD^a	IDEN^a	Cov.	Download PDB	Download FASTA
1	1m5q	0.869	1.31	0.985	1.0	1m5qY	1m5qY
2	1m5q	0.866	1.13	1.0	0.98	1m5qY1	1m5qY1
3	1i8f	0.865	1.26	0.212	1.0	1i8fF	1i8fF
4	3jcr	0.859	1.46	0.197	1.0	3jcr7	3jcr7
5	1i5l	0.856	1.25	0.277	0.98	1i5lC	1i5lC
6	5nrl	0.854	1.2	0.234	0.96	5nrle	5nrle
7	3jb9	0.852	1.15	0.281	0.96	3jb9I	3jb9I
8	3jb9	0.848	1.18	0.219	0.96	3jb9H	3jb9H
9	5mkl	0.848	1.29	0.338	0.98	5mkl11	5mkl11
10	5mkl	0.848	1.29	0.338	0.98	5mkl1	5mkl1

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by the length of the query protein.
(f)	Download PDB provides the structure of the aligned model and template.
(g)	Download FASTA provides the fasta format and full-length alignment of model and template. Shows alignment for potential ligand binding pockets and GO/EC terms.

Function and Ligand Binding Annotation for Proteins with Similar Structure

(a)	PDB Hit is the PDB of the specific domain/chain aligned to Model 1
(b)	RCSB Link is the RCSB PDB link of the full-length protein.
(c)	Gene Ontology (GO) term and Enzyme Commission (EC) number list the function annotations for structurally aligned proteins, as collected by BioLiP database.
(d)	Ligand lists known binding ligands for each aligned protein, as collected by BioLiP database.
(e)	Binding Site Residues lists the known binding residues for each ligand as collected by BioLiP database. The residue numbering is based on the specfic domain/chain numbering and highlighted residues means they are present in the alignment with Model 1. Note: Listed binding residues may not be representative of the full ligand binding pocket and may be part of a complex with another protein chain/domain. Also, for a single ligand, one template may have multiple binding sites.

Rank	PDB Hit	RCSB Link	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	1m5qY	1m5q		GO:0000398	GO:0005732
2	1m5qY1	1m5q		GO:0000398	GO:0005732
3	1i8fF	1i8f
4	3jcr7	3jcr	GO:0003723,GO:0005515,GO:0017070	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0043928	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0046540,GO:0071005,GO:0120115,GO:0005654,GO:0005829
5	1i5lC	1i5l				URI	H37 N39 R63 G64 D65
6	5nrle	5nrl	GO:0003723,GO:0005515,GO:1990935,GO:0003674	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0005687,GO:0005634,GO:0005681,GO:0005737,GO:0071004
7	3jb9I	3jb9	GO:0003723,GO:0003674	GO:0000395,GO:0000398,GO:0000387,GO:0006397,GO:0008380	GO:0005732,GO:0005681,GO:0005685,GO:0071013,GO:0046540,GO:0005634,GO:0005737,GO:0005829,GO:0005686,GO:0071014	NUC	K22 W23 S36 Y37 M38 R63 N65
8	3jb9H	3jb9	GO:0003723,GO:0003674	GO:0000398,GO:0000395,GO:0000387,GO:0006397,GO:0008380	GO:0005681,GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0005687,GO:0071004,GO:0005634,GO:0005737,GO:0005829,GO:0071014	NUC	F23 E24 Q25 F40 M41
9	5mkl11	5mkl
10	5mkl1	5mkl

Top Templates and Function Annotation from Component Threading Programs

LOMETS combines templates from multiple individual threading programs, as listed in the following tables.

(a)	Templates are ranked in descending order of normalized Z-score, as explained by (i) below.
(b)	PDB Hit is the PDB of the specific domain/chain aligned to the query.
(c)	RCSB Link is the RCSB PDB link of the full-length protein.
(d)	CMO is the contact map overlap score, calculated from the number of overlapping contacts between the predicted contact map and the contact map derived from the aligned template, then normalized by the number of predicted contacts.
(e)	MAE is the mean absolute error between the predicted distance map and the distance map derived from the aligned template.
(f)	ID1 is the number of template residues identical to query divided by the number of aligned residues.
(g)	ID2 is the number of template residues identical to query divided by the query sequence length.
(h)	Cov is equal to the number of aligned template residues divided by the query sequence length.
(i)	Norm. Zscore is the normalized Z-score of the threading alignments. A normalized Z-score ≥1 means a good alignment.
(j)	Download PDB provides the structure of the aligned region for each template.
(k)	Download FASTA provides the fasta format and full-length alignment of model and template. Shows alignment for potential ligand binding pockets and GO/EC terms.
(l)	Gene Ontology (GO) term and Enzyme Commission (EC) number list the function annotations for template proteins, as collected by BioLiP database.
(m)	Ligand lists known binding ligands for each template protein, as collected by BioLiP database.
(n)	Binding Site Residues lists the known binding residues for each ligand as collected by BioLiP database. The residue numbering is based on the template PDB numbering and highlighted residues means they are aligned with the query sequence. Note: Listed binding residues may not be representative of the full ligand binding pocket and may be part of a complex with another protein chain/domain. Also, for a single ligand, one template may have multiple binding sites.

Templates from Hybrid-CEthreader

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	1ljoA	1ljo	0.893	1.098	0.19	0.18	1.14	0.70	template_1	template_1		GO:0000398	GO:0005732
2	1n9sL	1n9s	0.879	1.193	0.24	0.24	1.12	0.70	template_2	template_2	GO:0003723,GO:0005515,GO:1990935,GO:0008266	GO:0000398,GO:0000387,GO:0006397,GO:0008380	GO:0005732,GO:0005681,GO:0005685,GO:0071013,GO:0005634,GO:0005682,GO:0005686,GO:0046540
3	5nrll	5nrl	0.893	1.099	0.24	0.24	1.50	0.70	template_3	template_3	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
4	5nrld	5nrl	0.879	1.048	0.23	0.23	1.26	0.69	template_4	template_4	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
5	1m8vA	1m8v	0.879	1.005	0.27	0.26	1.09	0.69	template_5	template_5				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
6	1d3bL	1d3b	0.872	1.018	0.14	0.14	1.36	0.69	template_6	template_6
7	3swnB	3swn	0.879	1.050	0.25	0.24	1.08	0.69	template_7	template_7	GO:0005515,GO:0003723,GO:0008266	GO:0000398,GO:0030490,GO:0045292,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:1905323	GO:0005732,GO:0000932,GO:0005688,GO:0005730,GO:0046540,GO:0005634,GO:0005681,GO:0005737,GO:0005697,GO:0120115	ZN ZN	E41 D57 S30 C31
8	2fwkA	2fwk	0.866	1.066	0.17	0.17	1.17	0.67	template_8	template_8
9	5mqfc	5mqf	0.859	1.157	0.20	0.20	1.20	0.67	template_9	template_9	GO:0003723,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0042633,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0005687,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005683,GO:0005689,GO:0005697,GO:0034709,GO:0034715,GO:0034719,GO:0071005,GO:0071007,GO:0071013,GO:0030532,GO:0005654
10	6ppqA	6ppq	0.852	1.095	0.21	0.20	1.05	0.67	template_10	template_10				NUC	Q29 F30 N32 R59 G60 E61

Templates from SparksX

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	5mkiA	5mki	0.846	1.087	0.24	0.23	1.06	2.22	template_1	template_1	GO:0003723
2	3swnA	3swn	0.866	1.169	0.17	0.17	1.15	2.17	template_2	template_2	GO:0003723,GO:0005515,GO:0008266	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0045292,GO:1905323	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732,GO:0005697,GO:0120115	ZN	E46 E55 H57
3	1m8vA	1m8v	0.879	1.054	0.27	0.26	1.09	2.12	template_3	template_3				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
4	1i8fF	1i8f	0.859	0.974	0.21	0.21	1.17	2.06	template_4	template_4
5	2fwkA	2fwk	0.799	1.220	0.17	0.17	1.17	2.01	template_5	template_5
6	6ppqA	6ppq	0.839	1.062	0.21	0.20	1.05	1.94	template_6	template_6				NUC	Q29 F30 N32 R59 G60 E61
7	4xq3A	4xq3	0.772	1.160	0.29	0.29	1.18	1.94	template_7	template_7		GO:0000398	GO:0005732
8	4c8qG	4c8q	0.819	1.203	0.24	0.24	1.05	1.91	template_8	template_8	GO:0003723,GO:0005515	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0030490	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0005737,GO:0005730,GO:0046540,GO:0005732
9	1n9sL	1n9s	0.859	1.176	0.24	0.24	1.12	1.91	template_9	template_9	GO:0003723,GO:0005515,GO:1990935,GO:0008266	GO:0000398,GO:0000387,GO:0006397,GO:0008380	GO:0005732,GO:0005681,GO:0005685,GO:0071013,GO:0005634,GO:0005682,GO:0005686,GO:0046540
10	5nrld	5nrl	0.879	1.048	0.23	0.23	1.26	1.91	template_10	template_10	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004

Templates from CEthreader

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	1ljoA	1ljo	0.893	1.098	0.19	0.18	1.14	0.56	template_1	template_1		GO:0000398	GO:0005732
2	1n9sL	1n9s	0.879	1.193	0.24	0.24	1.12	0.54	template_2	template_2	GO:0003723,GO:0005515,GO:1990935,GO:0008266	GO:0000398,GO:0000387,GO:0006397,GO:0008380	GO:0005732,GO:0005681,GO:0005685,GO:0071013,GO:0005634,GO:0005682,GO:0005686,GO:0046540
3	5nrll	5nrl	0.893	1.099	0.24	0.24	1.50	0.54	template_3	template_3	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
4	5nrld	5nrl	0.879	1.048	0.23	0.23	1.26	0.54	template_4	template_4	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
5	1m8vA	1m8v	0.879	1.005	0.27	0.26	1.09	0.54	template_5	template_5				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
6	1d3bL	1d3b	0.872	1.018	0.14	0.14	1.36	0.54	template_6	template_6
7	3swnB	3swn	0.879	1.050	0.25	0.24	1.08	0.54	template_7	template_7	GO:0005515,GO:0003723,GO:0008266	GO:0000398,GO:0030490,GO:0045292,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:1905323	GO:0005732,GO:0000932,GO:0005688,GO:0005730,GO:0046540,GO:0005634,GO:0005681,GO:0005737,GO:0005697,GO:0120115	ZN ZN	E41 D57 S30 C31
8	2fwkA	2fwk	0.866	1.066	0.17	0.17	1.17	0.52	template_8	template_8
9	5mqfc	5mqf	0.859	1.157	0.20	0.20	1.20	0.52	template_9	template_9	GO:0003723,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0042633,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0005687,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005683,GO:0005689,GO:0005697,GO:0034709,GO:0034715,GO:0034719,GO:0071005,GO:0071007,GO:0071013,GO:0030532,GO:0005654
10	6ppqA	6ppq	0.852	1.095	0.21	0.20	1.05	0.52	template_10	template_10				NUC	Q29 F30 N32 R59 G60 E61

Templates from HHsearch

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	4c8qE	4c8q	0.805	1.194	0.17	0.17	1.26	1.27	template_1	template_1	GO:0003723,GO:0005515	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0000398,GO:0000956	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732
2	3jb9G	3jb9	0.805	1.060	0.17	0.17	1.44	1.27	template_2	template_2	GO:0003674	GO:0000395,GO:0008380,GO:0000387,GO:0006397,GO:0000398	GO:0030532,GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0071013,GO:0071004,GO:0005634,GO:0000974,GO:0005681,GO:0071014	NUC	R30 N32 H45 N47 R82 G83 D84
3	1i8fF	1i8f	0.859	0.946	0.21	0.21	1.17	1.26	template_3	template_3
4	3swnA	3swn	0.846	1.067	0.17	0.17	1.15	1.26	template_4	template_4	GO:0003723,GO:0005515,GO:0008266	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0045292,GO:1905323	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732,GO:0005697,GO:0120115	ZN	E46 E55 H57
5	5nrll	5nrl	0.893	1.099	0.24	0.24	1.50	1.26	template_5	template_5	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
6	1d3bL	1d3b	0.872	1.033	0.14	0.14	1.36	1.25	template_6	template_6
7	5mqfg	5mqf	0.852	1.040	0.21	0.21	1.24	1.24	template_7	template_7	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
8	4c8qG	4c8q	0.819	1.203	0.24	0.24	1.05	1.24	template_8	template_8	GO:0003723,GO:0005515	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0030490	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0005737,GO:0005730,GO:0046540,GO:0005732
9	1m8vA	1m8v	0.879	1.005	0.27	0.26	1.09	1.24	template_9	template_9				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
10	6ppnH	6ppn	0.839	1.026	0.17	0.17	1.42	1.24	template_10	template_10				NUC	H30 T31 T32 N33 R61 G62 E63

Templates from MapAlign

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	1ljoA	1ljo	0.906	1.133	0.19	0.18	1.14	0.79	template_1	template_1		GO:0000398	GO:0005732
2	5nrll	5nrl	0.906	1.096	0.25	0.24	1.50	0.79	template_2	template_2	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
3	5nrld	5nrl	0.893	1.037	0.25	0.24	1.26	0.76	template_3	template_3	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
4	1m8vA	1m8v	0.893	1.032	0.27	0.26	1.09	0.76	template_4	template_4				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
5	2fwkA	2fwk	0.893	1.074	0.17	0.17	1.17	0.76	template_5	template_5
6	1n9sL	1n9s	0.879	1.198	0.28	0.26	1.12	0.76	template_6	template_6	GO:0003723,GO:0005515,GO:1990935,GO:0008266	GO:0000398,GO:0000387,GO:0006397,GO:0008380	GO:0005732,GO:0005681,GO:0005685,GO:0071013,GO:0005634,GO:0005682,GO:0005686,GO:0046540
7	1d3bL	1d3b	0.886	1.057	0.14	0.14	1.36	0.76	template_7	template_7
8	3swnB	3swn	0.879	0.989	0.25	0.24	1.08	0.74	template_8	template_8	GO:0005515,GO:0003723,GO:0008266	GO:0000398,GO:0030490,GO:0045292,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:1905323	GO:0005732,GO:0000932,GO:0005688,GO:0005730,GO:0046540,GO:0005634,GO:0005681,GO:0005737,GO:0005697,GO:0120115	ZN ZN	E41 D57 S30 C31
9	6ppnH	6ppn	0.852	1.093	0.18	0.17	1.42	0.74	template_9	template_9				NUC	H30 T31 T32 N33 R61 G62 E63
10	3swnA	3swn	0.866	1.072	0.17	0.17	1.15	0.74	template_10	template_10	GO:0003723,GO:0005515,GO:0008266	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0045292,GO:1905323	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732,GO:0005697,GO:0120115	ZN	E46 E55 H57

Templates from MUSTER

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	5nrll	5nrl	0.893	1.099	0.24	0.24	1.50	1.38	template_1	template_1	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
2	5mqfg	5mqf	0.852	1.104	0.21	0.21	1.24	1.28	template_2	template_2	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
3	5mqfe	5mqf	0.819	1.063	0.21	0.21	1.27	1.28	template_3	template_3	GO:0003723,GO:0071209,GO:0070034,GO:1990446,GO:0019899,GO:0005515,GO:0071208	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0006479,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0005697,GO:0016604,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
4	4m77A	4m77	0.785	1.115	0.21	0.20	1.26	1.27	template_4	template_4	GO:0003723,GO:0005515	GO:0000398,GO:0016070,GO:0006397,GO:0008380,GO:0006364,GO:0008033	GO:0005688,GO:0046540,GO:0005634,GO:0005681,GO:0005737,GO:0005730
5	5mkiA	5mki	0.846	1.073	0.24	0.23	1.06	1.26	template_5	template_5	GO:0003723
6	5nrld	5nrl	0.879	1.048	0.23	0.23	1.26	1.26	template_6	template_6	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
7	1m8vA	1m8v	0.879	1.054	0.27	0.26	1.09	1.24	template_7	template_7				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
8	1i8fF	1i8f	0.859	0.974	0.21	0.21	1.17	1.24	template_8	template_8
9	3jb9D	3jb9	0.819	1.105	0.23	0.23	1.45	1.22	template_9	template_9	GO:0003755,GO:0003723,GO:0005515,GO:0003729	GO:0000413,GO:0006457,GO:0000395,GO:0006396,GO:0000387,GO:0006397,GO:0008380	GO:0005681,GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0071004,GO:0005634,GO:0046540,GO:0071014	NUC	N35 N37 R61 G62 K81 P84 R96
10	5ganl	5gan	0.732	1.334	0.24	0.24	1.38	1.22	template_10	template_10	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532	NUC	K2 K8 K9 R11 K20 S33 P34 Q35 N37 R61 G62 N63 R66 L79 D82 Q83

Templates from MRFsearch

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	5mqfd	5mqf	0.846	1.064	0.23	0.23	1.12	0.60	template_1	template_1	GO:0003723,GO:0005515	GO:0000398,GO:0006397,GO:0008380,GO:0000387,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
2	5nrll	5nrl	0.899	1.081	0.25	0.24	1.50	0.60	template_2	template_2	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
3	4c8qG	4c8q	0.832	1.242	0.25	0.24	1.05	0.60	template_3	template_3	GO:0003723,GO:0005515	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0030490	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0005737,GO:0005730,GO:0046540,GO:0005732
4	5ganl	5gan	0.738	1.307	0.25	0.24	1.38	0.60	template_4	template_4	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532	NUC	K2 K8 K9 R11 K20 S33 P34 Q35 N37 R61 G62 N63 R66 L79 D82 Q83
5	3cw13	3cw1	0.792	1.283	0.23	0.23	1.11	0.58	template_5	template_5	GO:0003723,GO:0005515	GO:0000387,GO:0000398,GO:0006397,GO:0008380,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0005681,GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
6	4xq3A	4xq3	0.799	1.170	0.30	0.29	1.18	0.58	template_6	template_6		GO:0000398	GO:0005732
7	5ganr	5gan	0.792	1.202	0.19	0.18	1.05	0.58	template_7	template_7	GO:0003723,GO:0005515,GO:0003674	GO:0006397,GO:0008380,GO:0000398	GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005681,GO:0046540	NUC	N19 L35 N36 R57 G58
8	3swnA	3swn	0.859	1.146	0.17	0.17	1.15	0.58	template_8	template_8	GO:0003723,GO:0005515,GO:0008266	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0045292,GO:1905323	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732,GO:0005697,GO:0120115	ZN	E46 E55 H57
9	4c8qE	4c8q	0.819	1.299	0.17	0.17	1.26	0.58	template_9	template_9	GO:0003723,GO:0005515	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0000398,GO:0000956	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732
10	5mkiA	5mki	0.839	1.113	0.25	0.23	1.06	0.58	template_10	template_10	GO:0003723

Templates from DisCovER

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	5nrll	5nrl	0.893	1.113	0.25	0.24	1.50	0.75	template_1	template_1	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
2	4m77A	4m77	0.805	1.130	0.23	0.21	1.26	0.74	template_2	template_2	GO:0003723,GO:0005515	GO:0000398,GO:0016070,GO:0006397,GO:0008380,GO:0006364,GO:0008033	GO:0005688,GO:0046540,GO:0005634,GO:0005681,GO:0005737,GO:0005730
3	1i8fF	1i8f	0.859	0.961	0.22	0.21	1.17	0.72	template_3	template_3
4	6ppnH	6ppn	0.839	1.113	0.18	0.17	1.42	0.71	template_4	template_4				NUC	H30 T31 T32 N33 R61 G62 E63
5	4c8qG	4c8q	0.812	1.347	0.25	0.23	1.05	0.71	template_5	template_5	GO:0003723,GO:0005515	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0030490	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0005737,GO:0005730,GO:0046540,GO:0005732
6	5mqfe	5mqf	0.819	1.088	0.22	0.21	1.27	0.71	template_6	template_6	GO:0003723,GO:0071209,GO:0070034,GO:1990446,GO:0019899,GO:0005515,GO:0071208	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0006479,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0005697,GO:0016604,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
7	1m8vA	1m8v	0.839	1.131	0.28	0.26	1.09	0.71	template_7	template_7				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
8	5nrld	5nrl	0.879	1.018	0.23	0.23	1.26	0.70	template_8	template_8	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
9	5mqfg	5mqf	0.852	1.142	0.22	0.21	1.24	0.67	template_9	template_9	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
10	5mkiA	5mki	0.826	1.113	0.24	0.23	1.06	0.65	template_10	template_10	GO:0003723

Templates from FFAS3D

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	5mqfe	5mqf	0.765	1.491	0.20	0.20	1.27	1.07	template_1	template_1	GO:0003723,GO:0071209,GO:0070034,GO:1990446,GO:0019899,GO:0005515,GO:0071208	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0006479,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0005697,GO:0016604,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
2	5nrll	5nrl	0.832	1.456	0.21	0.21	1.50	1.05	template_2	template_2	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
3	3swnA	3swn	0.470	2.694	0.14	0.14	1.15	1.05	template_3	template_3	GO:0003723,GO:0005515,GO:0008266	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0045292,GO:1905323	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732,GO:0005697,GO:0120115	ZN	E46 E55 H57
4	5nrld	5nrl	0.799	1.544	0.20	0.20	1.26	1.04	template_4	template_4	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004
5	5mkiA	5mki	0.805	1.414	0.27	0.26	1.06	1.04	template_5	template_5	GO:0003723
6	5gann	5gan	0.758	1.519	0.20	0.20	1.24	1.04	template_6	template_6	GO:0003723,GO:0005515,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005737,GO:0046540,GO:0071004	NUC	N1 S36 N38 R62 G63 S64
7	4xq3A	4xq3	0.732	1.603	0.26	0.26	1.18	1.03	template_7	template_7		GO:0000398	GO:0005732
8	1m8vA	1m8v	0.477	2.616	0.24	0.23	1.09	1.02	template_8	template_8				NUC NUC NUC U	R3 L5 D6 H9 G32 Y33 D34 A1 R3 D34 H36 H36 N38 R62 D64
9	5mqfg	5mqf	0.799	1.458	0.20	0.20	1.24	1.02	template_9	template_9	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
10	6ppnH	6ppn	0.450	2.901	0.20	0.18	1.42	1.01	template_10	template_10				NUC	H30 T31 T32 N33 R61 G62 E63

Templates from EigenThreader

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	2vxeA	2vxe	0.752	1.447	0.17	0.17	1.33	0.80	template_1	template_1
2	2vxfA	2vxf	0.826	1.442	0.15	0.15	1.33	0.80	template_2	template_2	GO:0003674	GO:0008150	GO:0005575
3	7oqcb	7oqc	0.812	1.333	0.23	0.23	1.83	0.75	template_3	template_3
4	5mqfg	5mqf	0.866	1.097	0.21	0.21	1.24	0.73	template_4	template_4	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
5	5gank	5gan	0.832	1.272	0.23	0.23	1.21	0.73	template_5	template_5	GO:0003723,GO:0005515,GO:0003674	GO:0000398,GO:0006397,GO:0008380	GO:0005737,GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0071004,GO:0005687,GO:0071013,GO:0005634	NUC	R8 F34 K36 H37 N39 R66 G67 E68
6	5mqfd	5mqf	0.832	1.101	0.21	0.21	1.12	0.72	template_6	template_6	GO:0003723,GO:0005515	GO:0000398,GO:0006397,GO:0008380,GO:0000387,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
7	5ganr	5gan	0.725	1.403	0.18	0.18	1.05	0.72	template_7	template_7	GO:0003723,GO:0005515,GO:0003674	GO:0006397,GO:0008380,GO:0000398	GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005681,GO:0046540	NUC	N19 L35 N36 R57 G58
8	1i8fF	1i8f	0.859	0.946	0.21	0.21	1.17	0.72	template_8	template_8
9	4c8qG	4c8q	0.805	1.327	0.23	0.23	1.05	0.70	template_9	template_9	GO:0003723,GO:0005515	GO:0000398,GO:0000956,GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0030490	GO:0071004,GO:0005689,GO:0071013,GO:0005688,GO:1990726,GO:0005634,GO:0005681,GO:0005737,GO:0005730,GO:0046540,GO:0005732
10	5mqfe	5mqf	0.819	1.047	0.21	0.21	1.27	0.70	template_10	template_10	GO:0003723,GO:0071209,GO:0070034,GO:1990446,GO:0019899,GO:0005515,GO:0071208	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0006479,GO:0006369,GO:0008334,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0005697,GO:0016604,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532

Templates from HHpred

Rank	PDB Hit	RCSB Link	CMO	MAE	ID1	ID2	Cov	Norm. Zscore	Download PDB	Download FASTA	Gene_Ontology_(GO)_term (Molecular_Function)	Gene_Ontology_(GO)_term (Biological_Process)	Gene_Ontology_(GO)_term (Cellular_Componenet)	Ligand	Binding site residues
1	4c8qE	4c8q	0.805	1.194	0.17	0.17	1.26	1.19	template_1	template_1	GO:0003723,GO:0005515	GO:0006397,GO:0008380,GO:0006364,GO:0008033,GO:0000398,GO:0000956	GO:0005688,GO:0046540,GO:1990726,GO:0005634,GO:0005681,GO:0005730,GO:0005732
2	5ganr	5gan	0.758	1.203	0.18	0.18	1.05	1.33	template_2	template_2	GO:0003723,GO:0005515,GO:0003674	GO:0006397,GO:0008380,GO:0000398	GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005681,GO:0046540	NUC	N19 L35 N36 R57 G58
3	3cw13	3cw1	0.792	1.224	0.23	0.23	1.11	1.33	template_3	template_3	GO:0003723,GO:0005515	GO:0000387,GO:0000398,GO:0006397,GO:0008380,GO:0000245,GO:0006369,GO:0008334,GO:0051170	GO:0005681,GO:0071004,GO:0005689,GO:0071013,GO:0005686,GO:0005685,GO:0005682,GO:0005687,GO:0034719,GO:0043186,GO:0005634,GO:0005737,GO:0005829,GO:0005654,GO:0005683,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0030532
4	3cw1C	3cw1	0.799	1.255	0.17	0.17	1.33	1.21	template_4	template_4	GO:0005515,GO:0003723	GO:0008380,GO:0000398,GO:0000387,GO:0006397,GO:0000245,GO:0051170	GO:0030532,GO:0005686,GO:0005685,GO:0005682,GO:0046540,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0070062,GO:0005687,GO:0005689,GO:0034709,GO:0034715,GO:0034719,GO:0071005,GO:0071007,GO:0005654
5	5ganl	5gan	0.718	1.282	0.24	0.24	1.38	1.20	template_5	template_5	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532	NUC	K2 K8 K9 R11 K20 S33 P34 Q35 N37 R61 G62 N63 R66 L79 D82 Q83
6	1i8fF	1i8f	0.859	0.946	0.21	0.21	1.17	1.38	template_6	template_6
7	5mqfg	5mqf	0.852	1.040	0.21	0.21	1.24	1.30	template_7	template_7	GO:0003723,GO:1990446,GO:0005515	GO:0000398,GO:0000387,GO:0006397,GO:0008380,GO:0000245,GO:0051170	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005681,GO:0005737,GO:0005829,GO:0034709,GO:0046540,GO:0071005,GO:0071007,GO:0005654,GO:0030532
8	2fwkA	2fwk	0.839	1.118	0.17	0.17	1.17	1.27	template_8	template_8
9	5nrll	5nrl	0.893	1.099	0.24	0.24	1.50	1.28	template_9	template_9	GO:0003723,GO:0003729	GO:0000387,GO:0006397,GO:0008380,GO:0000398	GO:0005686,GO:0005685,GO:0000243,GO:0005682,GO:0005687,GO:0005689,GO:0034715,GO:0034719,GO:0071013,GO:0005634,GO:0005829,GO:0046540,GO:0071004,GO:0030532
10	6tflA	6tfl	0.678	1.388	0.27	0.23	0.94	1.15	template_10	template_10

[Click result.zip to download all results on this page]

References:
1.	W Zheng, Q Wuyun, X Zhou, Y Li, P Freddolino, Y Zhang. LOMETS3: Integrating deep-learning and profile-alignment for advanced protein template recognition and function annotation. in preparation, (2021)
2.	W Zheng, C Zhang, Q Wuyun, R Pearce, Y Li, Y Zhang. LOMETS2: improved meta-threading server for fold-recognition and structure-based function annotation for distant-homology proteins. Nucleic Acids Research, 47: W429-W436 (2019).
3.	S Wu, Y Zhang. LOMETS: A local meta-threading-server for protein structure prediction. Nucleic Acids Research, 35: 3375-3382 (2007).