[back]

COFACTOR result for job id 76534

[Download result.tar.bz2 for all prediction results]

User Input

>76534 (291 residues)
MTNIKKYLSIDIGGTSIKYGIFNENLNPLFINSITTIPIKDELLKQIIDIIISSLPLDGI
SIATAGVVDKNGVIKFANQNIKDYSNFDLKTYIKNFLITYKNSVPIEIINDANSASYIEY
VNNKTIKNSVTLTLGTGVGMGIILNGELFLANNGIAGEIGAIKNFDQYIDTDLSWTTFIK
KLNQNKYHYNSNDIWTLYNKNDFYKTEIENYLDKLVNLLCTISYILSPQIIYLGGGFSYC
SEQILELINNKFKKEFVFYDINPINIKYTSNKNDSGLLGVLHLLVDKHFKN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5nckA	0.96	0.74	0.287	0.969	Download
2	1z05A	0.91	1.83	0.165	0.976	Download
3	2qm1B	0.91	1.94	0.249	0.979	Download
4	3vgkA	0.88	1.88	0.228	0.949	Download
5	1z6rA	0.88	2.21	0.174	0.969	Download
6	2aa4A	0.86	1.89	0.217	0.935	Download
7	2gupA	0.86	2.22	0.208	0.942	Download
8	4htlA	0.85	1.92	0.230	0.924	Download
9	3mcpA	0.85	2.34	0.192	0.949	Download
10	1xc3A	0.84	1.77	0.216	0.907	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	1.00	catalytic activity
GO:0016772	0.98	transferase activity, transferring phosphorus-containing groups
GO:0016773	0.97	phosphotransferase activity, alcohol group as acceptor
GO:0019200	0.92	carbohydrate kinase activity
GO:0004340	0.90	glucokinase activity
GO:0043167	0.75	ion binding
GO:0046872	0.74	metal ion binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.99	cellular process
GO:0008152	0.99	metabolic process
GO:0044237	0.98	cellular metabolic process
GO:0006796	0.96	phosphate-containing compound metabolic process
GO:0071704	0.95	organic substance metabolic process
GO:0016310	0.91	phosphorylation
GO:1901135	0.89	carbohydrate derivative metabolic process
GO:0019637	0.88	organophosphate metabolic process
GO:0044238	0.87	primary metabolic process
GO:0051156	0.86	glucose 6-phosphate metabolic process
GO:0044281	0.85	small molecule metabolic process
GO:0006807	0.82	nitrogen compound metabolic process
GO:0005975	0.82	carbohydrate metabolic process
GO:1901575	0.81	organic substance catabolic process
GO:0034641	0.81	cellular nitrogen compound metabolic process
GO:1901564	0.80	organonitrogen compound metabolic process
GO:1901360	0.80	organic cyclic compound metabolic process
GO:0046483	0.80	heterocycle metabolic process
GO:0006725	0.80	cellular aromatic compound metabolic process
GO:0006139	0.79	nucleobase-containing compound metabolic process
GO:0044723	0.78	single-organism carbohydrate metabolic process
GO:0019752	0.78	carboxylic acid metabolic process
GO:0016052	0.78	carbohydrate catabolic process
GO:0055086	0.77	nucleobase-containing small molecule metabolic process
GO:0044712	0.77	single-organism catabolic process
GO:0044724	0.76	single-organism carbohydrate catabolic process
GO:0032787	0.76	monocarboxylic acid metabolic process
GO:0009259	0.76	ribonucleotide metabolic process
GO:0006732	0.76	coenzyme metabolic process
GO:0006096	0.75	glycolytic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005737	1.00	cytoplasm
GO:0044444	0.63	cytoplasmic part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.576	2aa4A	0.865	1.89	0.217	0.935	2.7.1.60	111
2	0.540	3eo3A	0.816	1.62	0.194	0.866	5.1.3.14 2.7.1.60	111
3	0.519	1xc3A	0.845	1.77	0.216	0.907	2.7.1.4	111
4	0.487	1woqA	0.738	2.27	0.230	0.821	2.7.1.63	111
5	0.483	2ap1A	0.811	2.82	0.229	0.945	2.7.1.59	111

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.46	3vglA	0.822	2.75	0.224	0.952	1.17	BGC	Download	65,66,110,111,138,139,158,161
2	0.27	3vglA	0.822	2.75	0.224	0.952	1.06	NA	Download	110,112,113,140,156,157,158
3	0.18	2qm1A	0.843	2.79	0.237	0.973	1.35	MG	Download	110,112,113,141
4	0.10	2gupA	0.880	2.15	0.204	0.959	1.24	SUC	Download	11,18,115,235,236,272,273,276
5	0.09	1hkbA	0.783	3.51	0.113	0.959	0.88	G6P	Download	11,14,65,111,135,136,276
6	0.08	3lm9A	0.843	1.80	0.216	0.907	1.34	ADP	Download	135,136,175,176,179,191,192,235,236,239,240
7	0.05	2aa40	0.865	1.89	0.217	0.935	0.90	III	Download	128,144,151,152,153,154,155,156,157,158,161,162,163,164,217,220,221,223,224,225,227

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]