Example Output of EM-Refiner

[Download result.tar.bz2 for all fitting results]

Protein Sequence in FASTA format

>protein
KDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKYAVKN
PLFVLPLPRPVELQYVQWQFAGPNTVHCLITSLAEYKLHQDFAKPHTTIQFHLDLANDKD
MVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETSIAKERIQLLEDFNKGSQNFDIN
KLIQLAQSMEN

Initial model, superposed model and refined model from EM-Refiner

To adjust the protein orientation by using the mouse

Initial Model

Density Map

Superposed Model

CC=0.354219

Refined Model

CC=0.481247

Per-residue correlation between initial structural model and input density map

The correlation coefficient is a statistical measure of the strength of the relationship between the calculated and experimental density maps. Here, CC(i) represents the correlation coefficient between the residue i in the initial model and the corresponding grid point in input density map.

Per-residue correlation between final structural model and input density map

The correlation coefficient is a statistical measure of the strength of the relationship between the calculated and experimental density maps. Here, CC(i) represents the correlation coefficient between the residue i in the final model and the corresponding grid point in input density map.

Reference:

Biao Zhang, Xi Zhang, Robin Pearce, Hongbin Shen, Yang Zhang. A new protocol for atomic-level protein structure modeling and refinement using low-to-mdeium resolution cryo-EM density maps. Journal of Molecular Biology, 2020. [back to server]